Gene Information

Name : SHJGH_3626 (SHJGH_3626)
Accession : YP_007692625.1
Strain : Streptomyces hygroscopicus TL01
Genome accession: NC_020895
Putative virulence/resistance : Resistance
Product : tellurium resistance protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 4150815 - 4151390 bp
Length : 576 bp
Strand : -
Note : -

DNA sequence :
GTGGGAGTCAGCCTCAGCAAGGGCGGCAACGTATCGCTGACGAAGGAGGCCCCGGGCCTGACCGCCGTCATCGTCGGCCT
GGGGTGGGACGTGCGCACGACGACCGGCACGGACTTCGACCTCGACGCCAGCGCGCTGCTGCTGAACAACTCCGGCAAGG
TCATCAGCGACCAGCACTTCGTCTTCTTCAACAACCTCAAGAGCCCCGACGGCTCGGTCGAGCACACCGGTGACAACCTC
ACCGGTGAGGGCGAGGGCGACGACGAACAGATCAAGGTCAATCTGGCCGGTGTCCCGGCCGACGTCGACAAGATCGTGTT
CCCGGTGTCGATCTACGACGCCGAGAACCGCCAGCAGTCCTTCGGCCAGGTCCGCAACGCCTTCATCCGCGTCGTGAACC
AGGCCGGCGGGCAGGAGATCGCCCGGTACGACCTCAGTGAGGACGCCTCCACCGAGACCGCCATGGTCTTCGGCGAGCTG
TACCGGCACGGCGCGGAGTGGAAGTTCCGCGCCATCGGCCAGGGCTACGCGTCGGGCCTGCGGGGCATCGCGCAGGACTT
CGGCGTCAACGTCTGA

Protein sequence :
MGVSLSKGGNVSLTKEAPGLTAVIVGLGWDVRTTTGTDFDLDASALLLNNSGKVISDQHFVFFNNLKSPDGSVEHTGDNL
TGEGEGDDEQIKVNLAGVPADVDKIVFPVSIYDAENRQQSFGQVRNAFIRVVNQAGGQEIARYDLSEDASTETAMVFGEL
YRHGAEWKFRAIGQGYASGLRGIAQDFGVNV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 1e-64 70
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-60 67
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 2e-60 67
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-60 67
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 5e-62 66
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 5e-62 66
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 4e-59 66
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 1e-61 65
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 2e-32 45
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 7e-30 44
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 7e-30 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SHJGH_3626 YP_007692625.1 tellurium resistance protein BAC0389 Protein 1e-61 66
SHJGH_3626 YP_007692625.1 tellurium resistance protein BAC0390 Protein 1e-61 65
SHJGH_3626 YP_007692625.1 tellurium resistance protein BAC0392 Protein 3e-29 43