Gene Information

Name : D648_1410 (D648_1410)
Accession : YP_007667654.1
Strain : Mannheimia haemolytica USDA-ARS-USMARC-185
Genome accession: NC_020834
Putative virulence/resistance : Resistance
Product : drug resistance protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 135183 - 135506 bp
Length : 324 bp
Strand : -
Note : Membrane transporters of cations and cationic drugs COG2076; Possible drug resistance protein of Pasteurellaceae UniRef RepID=B0BRT3_ACTPJ

DNA sequence :
ATGAACGTTTGGATTTTACTTGCGATTTCCATCTGCCTCGAAATCGCTGCCACCAATTTACTCAAATTAAGCAACGGCTT
CACCAAAGCTATACCGACTATTGGCTCGCTCGCCTTATACGGTTTATCCTTTTACTTTCTCTCTATTATTTTCCGCACCC
TACCGGTCGGAATCGTGTATGCTATTTGGTCCGGCGTAGGGATTGTCCTTACCGCCCTTGTTGCTTATTTTGCTTTCGGA
CAGAAAATTGACTTGGCAGGCTTAATCGGCATCAGCCTCATTATTGCCGGTGTATTGGTGATTAATTTGTTTTCTAAAGT
GTGA

Protein sequence :
MNVWILLAISICLEIAATNLLKLSNGFTKAIPTIGSLALYGLSFYFLSIIFRTLPVGIVYAIWSGVGIVLTALVAYFAFG
QKIDLAGLIGISLIIAGVLVINLFSKV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
qacEdelta1 AGK07100.1 QacEdelta1 Not tested SGI1 Protein 7e-14 46
qacEdelta1 AGF34989.1 QacEdelta1 Not tested SGI1 Protein 7e-14 46
qacEdelta1 CAJ77049.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 7e-14 46
qacEdelta1 YP_005797150.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 1e-13 46
qacEdelta1 AGK07109.1 QacEdelta1 Not tested SGI1 Protein 7e-14 46
qacEdelta1 AGF35028.1 QacEdelta1 Not tested SGI1 Protein 7e-14 46
qacEdelta1 CAJ77052.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 7e-14 46
ebr YP_006098377.1 putative ethidium bromide resistance protein Not tested Tn2411 Protein 1e-13 46
qacEdelta1 AFV53123.1 QacEdelta1 multidrug exporter Not tested AbGRI2-1 Protein 7e-14 46
qacEdelta1 AGF35063.1 QacEdelta1 Not tested SGI1 Protein 7e-14 46
qacEdelta1 CAJ77088.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 7e-14 46
qacEdelta1 ACN81026.1 QacEdelta1 Not tested AbaR5 Protein 1e-13 46
qacEdelta1 AGK36647.1 QacEdelta1 Not tested AbaR26 Protein 7e-14 46
qacEdelta1 AGK06933.1 QacEdelta1 Not tested SGI1 Protein 7e-14 46
qacE-deltal ACF06159.1 quartenary ammonium compound resistance protein Not tested Tn5036-like Protein 7e-14 46
qacEdelta1 AAK02047.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 7e-14 46
qacEdelta1 AGK06970.1 QacEdelta1 Not tested SGI1 Protein 7e-14 46
qacE-delta1 ACY75523.1 QacE-delta1 Not tested Tn6060 Protein 7e-14 46
qacEdelta1 AAK02056.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 7e-14 46
qacEdelta1 AGK06979.1 QacEdelta1 Not tested SGI1 Protein 7e-14 46
qacE-delta1 ACY75532.1 QacE-delta1 Not tested Tn6060 Protein 7e-14 46
qacEdelta1 ABB48428.1 QacEdelta1 Not tested SGI1 Protein 7e-14 46
qacEdelta1 AGK07016.1 QacEdelta1 Not tested SGI1 Protein 7e-14 46
qacE-delta1 AET25389.1 QacE-delta1 Not tested PAGI-2(C) Protein 7e-14 46
qacEdelta1 ABZ01839.1 QacEdelta1 Not tested SGI2 Protein 7e-14 46
ACICU_00227 YP_001844886.1 membrane transporter Not tested AbaR20 Protein 1e-13 46
qacEdelta1 AGK07074.1 QacEdelta1 Not tested SGI1 Protein 7e-14 46
qacE-delta1 AFG30112.1 QacE-delta1 Not tested PAGI-2 Protein 7e-14 46
qacEdelta1 CAJ77030.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 7e-14 46
qacEdelta1 YP_005797134.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 1e-13 46

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
D648_1410 YP_007667654.1 drug resistance protein CP001138.1.gene1489. Protein 1e-11 54
D648_1410 YP_007667654.1 drug resistance protein BAC0324 Protein 2e-15 53
D648_1410 YP_007667654.1 drug resistance protein BAC0322 Protein 3e-14 46
D648_1410 YP_007667654.1 drug resistance protein BAC0323 Protein 3e-14 46
D648_1410 YP_007667654.1 drug resistance protein BAC0327 Protein 4e-11 45
D648_1410 YP_007667654.1 drug resistance protein BAC0329 Protein 4e-10 44
D648_1410 YP_007667654.1 drug resistance protein BAC0321 Protein 4e-12 43
D648_1410 YP_007667654.1 drug resistance protein BAC0326 Protein 2e-09 41