Gene Information

Name : I653_01435 (I653_01435)
Accession : YP_007661065.1
Strain : subtilis subtilis BAB-1
Genome accession: NC_020832
Putative virulence/resistance : Resistance
Product : putative stress adaptation protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 304298 - 304876 bp
Length : 579 bp
Strand : +
Note : COG2310 Uncharacterized proteins involved in stress response, homologs of TerZ and putative cAMP-binding protein CABP1

DNA sequence :
ATGGCCATTCAATTATCAAAAGGACAGCGCATTGATTTAACAAAAACAAATCCGGGACTGACAAAAGCGGTGATCGGCTT
AGGCTGGGATACAAACAAGTACTCTGGCGGAGAGGATTTTGACCTGGATGCTTCGGCCTTTTTAGTTGATGCGCATGATA
ACTGCGTAAATGATCTCGATTTCGTCTTCTATAATAACCTTGAACATCCGAGCGGCGGTGTCATCCATACGGGTGACAAC
CGCACGGGTGAGGGCGACGGAGATGATGAGCAGATTATCGTTGATTTCTCAAAAATCCCTGCTCACATTGAGAAAATCGG
CATCACAGTGACCATTCACGACGCTGAAGCACGCAGCCAAAACTTTGGACAAGTTTCCAATGCATTTGTCCGCGTTGTGG
ATGAAGAAACGCAGAATGAGCTTCTTCGCTTCGATTTGGGAGAAGACTTCTCCATTGAAACAGCTGTTGTCGTTTGTGAG
CTTTACAGACACGGCGACGAGTGGAAATTCAATGCGATCGGCAGCGGATTTTCCGGCGGGCTGGCTGCATTGTGCCGGAA
TTACGGTTTGCAAGTGTAA

Protein sequence :
MAIQLSKGQRIDLTKTNPGLTKAVIGLGWDTNKYSGGEDFDLDASAFLVDAHDNCVNDLDFVFYNNLEHPSGGVIHTGDN
RTGEGDGDDEQIIVDFSKIPAHIEKIGITVTIHDAEARSQNFGQVSNAFVRVVDEETQNELLRFDLGEDFSIETAVVVCE
LYRHGDEWKFNAIGSGFSGGLAALCRNYGLQV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 3e-53 57
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 3e-47 54
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-47 54
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-47 54
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-51 53
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-51 53
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 6e-51 52
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 2e-45 50
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 2e-27 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
I653_01435 YP_007661065.1 putative stress adaptation protein BAC0390 Protein 3e-51 55
I653_01435 YP_007661065.1 putative stress adaptation protein BAC0389 Protein 2e-51 53