Gene Information

Name : H681_17275 (H681_17275)
Accession : YP_007658863.1
Strain : Pseudomonas denitrificans ATCC 13867
Genome accession: NC_020829
Putative virulence/resistance : Virulence
Product : putative two-component response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3900913 - 3901605 bp
Length : 693 bp
Strand : -
Note : COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain

DNA sequence : 
ATGCGCGTACTGATTGTCGAAGACGAGAGCAAGACCGCCGACTACCTGCAGCGCGGGCTGAGCGAGCAGGGCTTCACCGT
GGACGTCGCCAGCAACGGCATCGACGGCCGGCACCTGGCGCTCAATGGCGAATACGACGTCATCGTCCTCGACGTGATGC
TCCCCGGCATCGACGGCTACGGCGTGCTGCGCGCCCTGCGTGAACAGCGGCAGACGCCGGTGATCATGCTCACCGCCCGC
GAGCGTGTGGAAGACCGCGTGCGCGGCCTGCGCGAGGGCGCCGACGATTACCTGATCAAGCCGTTCTCCTTCCTCGAACT
GGTGGCGCGCCTGCAAGCCCTGACCCGCCGTGGCGCACACCTGGAAAGCGCCACACAGATGCGCATCGCCGACCTCGCCA
TCGATCTGGTCAGCCGCCGCGTGCAGCGTGGCGGCACGCGCCTGGAACTGACCGCCAAGGAGTATTCGCTGCTCTGCGTG
CTGGCCCAGCGCAGTGGCGAAATCCTCTCCAAGACGGCCATCGCCGAGCTGGTCTGGGACATCAATTTCGACACCGACAC
CAACGTCGTGGAGGTCGCCATCAAGCGTCTGCGCGCCAAGCTCGACGGGCCCTTCGACACTAAGCTGCTGCATACCATCC
GGGGCATGGGCTACGTGCTGGAAAGCCGCACGGCCCAGGAGCGCGAGGCGTGA

Protein sequence : 
MRVLIVEDESKTADYLQRGLSEQGFTVDVASNGIDGRHLALNGEYDVIVLDVMLPGIDGYGVLRALREQRQTPVIMLTAR
ERVEDRVRGLREGADDYLIKPFSFLELVARLQALTRRGAHLESATQMRIADLAIDLVSRRVQRGGTRLELTAKEYSLLCV
LAQRSGEILSKTAIAELVWDINFDTDTNVVEVAIKRLRAKLDGPFDTKLLHTIRGMGYVLESRTAQEREA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-57 54
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-56 53

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
H681_17275 YP_007658863.1 putative two-component response regulator BAC0125 Protein 7e-64 61
H681_17275 YP_007658863.1 putative two-component response regulator BAC0083 Protein 6e-61 58
H681_17275 YP_007658863.1 putative two-component response regulator BAC0197 Protein 9e-60 57
H681_17275 YP_007658863.1 putative two-component response regulator BAC0308 Protein 2e-56 56
H681_17275 YP_007658863.1 putative two-component response regulator BAC0638 Protein 2e-56 56
H681_17275 YP_007658863.1 putative two-component response regulator BAC0111 Protein 2e-62 53
H681_17275 YP_007658863.1 putative two-component response regulator BAC0347 Protein 6e-57 51
H681_17275 YP_007658863.1 putative two-component response regulator NC_003923.1003417.p0 Protein 9e-37 41
H681_17275 YP_007658863.1 putative two-component response regulator NC_013450.8614146.p0 Protein 9e-37 41
H681_17275 YP_007658863.1 putative two-component response regulator NC_002951.3238224.p0 Protein 9e-37 41
H681_17275 YP_007658863.1 putative two-component response regulator NC_007793.3914065.p0 Protein 9e-37 41
H681_17275 YP_007658863.1 putative two-component response regulator NC_002758.1121390.p0 Protein 9e-37 41
H681_17275 YP_007658863.1 putative two-component response regulator NC_010079.5776364.p0 Protein 9e-37 41
H681_17275 YP_007658863.1 putative two-component response regulator NC_002952.2859858.p0 Protein 9e-37 41
H681_17275 YP_007658863.1 putative two-component response regulator NC_007622.3794948.p0 Protein 9e-37 41
H681_17275 YP_007658863.1 putative two-component response regulator AE015929.1.gene1106. Protein 4e-32 41
H681_17275 YP_007658863.1 putative two-component response regulator HE999704.1.gene1528. Protein 2e-33 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
H681_17275 YP_007658863.1 putative two-component response regulator VFG0596 Protein 5e-58 54
H681_17275 YP_007658863.1 putative two-component response regulator VFG1389 Protein 1e-38 45
H681_17275 YP_007658863.1 putative two-component response regulator VFG1390 Protein 1e-38 42
H681_17275 YP_007658863.1 putative two-component response regulator VFG1386 Protein 4e-35 41