Gene Information

Name : H681_15505 (H681_15505)
Accession : YP_007658509.1
Strain : Pseudomonas denitrificans ATCC 13867
Genome accession: NC_020829
Putative virulence/resistance : Virulence
Product : two-component response regulator, CopR
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3499174 - 3499854 bp
Length : 681 bp
Strand : +
Note : COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain

DNA sequence :
ATGAAACTCCTGATCGTCGAAGACGAACCCCGCATCGGCCAGTACCTGCGGCAGGGCCTGAACGAAGCCGGCTTCGCCGT
GGACCTCTGCCAGGACGGCGACGAAGGCCTGCAACTGGCGCTCTCCGGCGAACACGACCTGCTGATCCTCGATGTCATGC
TGCCCGGCCGCGACGGCTGGCAGATCCTCCAGGCCGTGCGCCAGACCGGCAGCGCGGTGCCGGTGCTGTTCCTCACCGCG
CGCGATGCGGTGGAAGACCGCGTGCGCGGGCTGGAGCAAGGCGCCGACGACTACCTGGTGAAGCCCTTCGCCTTCGTCGA
ATTGCTGGCGCGGGTACGCACCCTGCTGCGGCGGGGTGGCCAGCAGTTGCAGGAAACCACCCTGCAACTGGCCGACCTGG
AATTGGACCTGCTGCGCCGCCGGGTACAGCGCGCCGGCAAGCGCATCGACCTGACCGCCAAGGAGTTCGCCCTGCTGGAG
CTGCTGCTGCGGCGCAGCGGCGAAGTGCTGCCCAAGTCGCTGATCGCCTCGCAGGTCTGGGACATGAACTTCGACAGCGA
CACCAACGTCATCGAGGTCGCCATCCGCCGCCTGCGCGCCAAGGTCGACGACGAGTTTCCGCAGCGCCTGATCCACACCG
TGCGCGGCATGGGCTACGTGCTGGAAGAGCGCGACGCATGA

Protein sequence :
MKLLIVEDEPRIGQYLRQGLNEAGFAVDLCQDGDEGLQLALSGEHDLLILDVMLPGRDGWQILQAVRQTGSAVPVLFLTA
RDAVEDRVRGLEQGADDYLVKPFAFVELLARVRTLLRRGGQQLQETTLQLADLELDLLRRRVQRAGKRIDLTAKEFALLE
LLLRRSGEVLPKSLIASQVWDMNFDSDTNVIEVAIRRLRAKVDDEFPQRLIHTVRGMGYVLEERDA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-51 56
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-50 54

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
H681_15505 YP_007658509.1 two-component response regulator, CopR BAC0638 Protein 2e-60 74
H681_15505 YP_007658509.1 two-component response regulator, CopR BAC0083 Protein 4e-64 70
H681_15505 YP_007658509.1 two-component response regulator, CopR BAC0111 Protein 1e-61 62
H681_15505 YP_007658509.1 two-component response regulator, CopR BAC0308 Protein 8e-60 62
H681_15505 YP_007658509.1 two-component response regulator, CopR BAC0197 Protein 6e-58 61
H681_15505 YP_007658509.1 two-component response regulator, CopR BAC0347 Protein 1e-53 58
H681_15505 YP_007658509.1 two-component response regulator, CopR BAC0125 Protein 2e-57 58
H681_15505 YP_007658509.1 two-component response regulator, CopR BAC0487 Protein 1e-22 41
H681_15505 YP_007658509.1 two-component response regulator, CopR NC_002516.2.879194.p Protein 1e-24 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
H681_15505 YP_007658509.1 two-component response regulator, CopR VFG0596 Protein 1e-51 56
H681_15505 YP_007658509.1 two-component response regulator, CopR VFG1390 Protein 9e-38 46
H681_15505 YP_007658509.1 two-component response regulator, CopR VFG1389 Protein 2e-29 43