Gene Information

Name : A11Q_935 (A11Q_935)
Accession : YP_007644758.1
Strain : Bdellovibrio exovorus JSS
Genome accession: NC_020813
Putative virulence/resistance : Virulence
Product : putative 2-component transcriptional regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 934537 - 935217 bp
Length : 681 bp
Strand : -
Note : COG0745TK

DNA sequence :
ATGCGTATTCTTGTAGTCGAAGATGAAGTTAAAACCTCGCAGTTCATTAAAAAAGGCCTTAATGAAGTGGGCTATGCTGT
AGACGTGGCGGAATCAGGTCCCACAGCTGAATCCTATGTGGCCAGTAGTGAATATGATTTAATTATTCTAGATGTGATGC
TTCCTGGCCCTAGTGGCGTCGATACAACACGTCACTTACGACGGGATGGCTTCAAGGGTCCTATTCTTCTTCTAACTGCT
CTCACCACCACCAAAGACAAAGTAAATGGGCTTGATGCAGGTGCTGATGATTATCTAACGAAACCCTTCTCTTTTGAAGA
GCTTTTGGCGCGAGTGCGAGCTCTTCTACGTCGTACACAGTCGGCAAGCAGTATTGATTCCGTACTCAAGTTTTCTGACA
TCGAAATGGATTTGGTACGTAGAAAAGTGAAAAGACAAAATGTCGAAATCACCCTAACGACAAAAGAGTTCTCGCTATTA
GAGTACTTTCTTAGAAATCCCGAGATCCCCCTAGGACGTGTTTCTATAGCCGAACATGTGTGGGATTTAAACTTTGATTC
AGGAAGTAACGTGATCGATGTCTACGTTAATTTACTAAGAAAGAAAGTAGATGCAGCTTCATTCAATAAAAAATTAATCC
ATACGGTTGTTGGCGTTGGTTACATTCTTAAAGAAGCCTAA

Protein sequence :
MRILVVEDEVKTSQFIKKGLNEVGYAVDVAESGPTAESYVASSEYDLIILDVMLPGPSGVDTTRHLRRDGFKGPILLLTA
LTTTKDKVNGLDAGADDYLTKPFSFEELLARVRALLRRTQSASSIDSVLKFSDIEMDLVRRKVKRQNVEITLTTKEFSLL
EYFLRNPEIPLGRVSIAEHVWDLNFDSGSNVIDVYVNLLRKKVDAASFNKKLIHTVVGVGYILKEA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-32 46
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 4e-32 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
A11Q_935 YP_007644758.1 putative 2-component transcriptional regulator BAC0111 Protein 6e-43 54
A11Q_935 YP_007644758.1 putative 2-component transcriptional regulator BAC0347 Protein 2e-37 51
A11Q_935 YP_007644758.1 putative 2-component transcriptional regulator BAC0197 Protein 4e-41 51
A11Q_935 YP_007644758.1 putative 2-component transcriptional regulator BAC0308 Protein 5e-37 50
A11Q_935 YP_007644758.1 putative 2-component transcriptional regulator BAC0638 Protein 1e-31 48
A11Q_935 YP_007644758.1 putative 2-component transcriptional regulator BAC0125 Protein 3e-39 47
A11Q_935 YP_007644758.1 putative 2-component transcriptional regulator BAC0083 Protein 4e-38 47
A11Q_935 YP_007644758.1 putative 2-component transcriptional regulator NC_010079.5776364.p0 Protein 1e-23 42
A11Q_935 YP_007644758.1 putative 2-component transcriptional regulator NC_002952.2859858.p0 Protein 1e-23 42
A11Q_935 YP_007644758.1 putative 2-component transcriptional regulator NC_007622.3794948.p0 Protein 1e-23 42
A11Q_935 YP_007644758.1 putative 2-component transcriptional regulator NC_003923.1003417.p0 Protein 1e-23 42
A11Q_935 YP_007644758.1 putative 2-component transcriptional regulator NC_013450.8614146.p0 Protein 1e-23 42
A11Q_935 YP_007644758.1 putative 2-component transcriptional regulator NC_002951.3238224.p0 Protein 1e-23 42
A11Q_935 YP_007644758.1 putative 2-component transcriptional regulator NC_007793.3914065.p0 Protein 1e-23 42
A11Q_935 YP_007644758.1 putative 2-component transcriptional regulator NC_002758.1121390.p0 Protein 1e-23 42
A11Q_935 YP_007644758.1 putative 2-component transcriptional regulator AE015929.1.gene1106. Protein 4e-22 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
A11Q_935 YP_007644758.1 putative 2-component transcriptional regulator VFG1390 Protein 1e-37 47
A11Q_935 YP_007644758.1 putative 2-component transcriptional regulator VFG0596 Protein 5e-33 46
A11Q_935 YP_007644758.1 putative 2-component transcriptional regulator VFG1386 Protein 4e-32 41