Gene Information

Name : A11S_1912 (A11S_1912)
Accession : YP_007643333.1
Strain : Micavibrio aeruginosavorus EPB
Genome accession: NC_020812
Putative virulence/resistance : Virulence
Product : response regulator in two-component regulatory system with PhoQ
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1949847 - 1950530 bp
Length : 684 bp
Strand : -
Note : -

DNA sequence : 
ATGAAAATTCTTATTGTTGAAGATGATCAGAAGATAAGGGATTACATCCATAAGGGCCTTAAAGAAGCCGGCCATGTCGT
GGACCTTGCCGCGGATGGCGAGGCGGGATTGCATCTGGCATCAAATGAAAAATATGATGTTTTAGTGATTGACCGCATGT
TGCCAAAGATGGACGGCCTGTCTGTCATACGAACATTGCGTGGCAGTGGGAACCTTACGGGTGTCCTGATTTTAAGCGCG
CTTGGTGATGTTGATGACCGGGTATCCGGCCTTCGCTCTGGCGGGGATGATTATCTTGTTAAACCGTTCGCGTTTATCGA
GCTCCTTGCGCGCGTTGAGGCACTGGGCAAACGATCGGCAGTGGCCAATAAAACGCAGCAATCAGCCATTCTAACAGCCT
GTGACCTTGAAATGGATCTTTTAAGTCGCAAGGTGAAACGCGCGGGCCGTTTTATTGAATTGCAGGCGCGCGAGTTTCAG
CTTCTCGAGTATCTGTTGAAGTTTAAAGGCCAGCTTGTAACCCGGACAATGTTACTGGAGGGTGTGTGGGATTATCATTT
TGATCCACAAACCAGCGTCATCGACGTGCATATCAGCCGTCTGCGCAAAAAGCTGGGTGATGCGGATAACAGTTTTATCA
AGACGGTGCGCGGTGCGGGATACATTATCGAAGACAGTTTCTAG

Protein sequence : 
MKILIVEDDQKIRDYIHKGLKEAGHVVDLAADGEAGLHLASNEKYDVLVIDRMLPKMDGLSVIRTLRGSGNLTGVLILSA
LGDVDDRVSGLRSGGDDYLVKPFAFIELLARVEALGKRSAVANKTQQSAILTACDLEMDLLSRKVKRAGRFIELQAREFQ
LLEYLLKFKGQLVTRTMLLEGVWDYHFDPQTSVIDVHISRLRKKLGDADNSFIKTVRGAGYIIEDSF

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 4e-41 45
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 7e-40 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
A11S_1912 YP_007643333.1 response regulator in two-component regulatory system with PhoQ BAC0347 Protein 2e-44 48
A11S_1912 YP_007643333.1 response regulator in two-component regulatory system with PhoQ BAC0111 Protein 6e-49 48
A11S_1912 YP_007643333.1 response regulator in two-component regulatory system with PhoQ BAC0125 Protein 2e-48 47
A11S_1912 YP_007643333.1 response regulator in two-component regulatory system with PhoQ BAC0083 Protein 2e-43 46
A11S_1912 YP_007643333.1 response regulator in two-component regulatory system with PhoQ BAC0197 Protein 3e-43 46
A11S_1912 YP_007643333.1 response regulator in two-component regulatory system with PhoQ BAC0308 Protein 4e-42 45
A11S_1912 YP_007643333.1 response regulator in two-component regulatory system with PhoQ BAC0638 Protein 7e-38 44

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
A11S_1912 YP_007643333.1 response regulator in two-component regulatory system with PhoQ VFG0596 Protein 1e-41 45
A11S_1912 YP_007643333.1 response regulator in two-component regulatory system with PhoQ VFG1389 Protein 2e-34 41