Gene Information

Name : F504_562 (F504_562)
Accession : YP_007631581.1
Strain : Ralstonia solanacearum FQY_4
Genome accession: NC_020799
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator, winged helix family
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 578208 - 578906 bp
Length : 699 bp
Strand : -
Note : -

DNA sequence : 
ATGCGCATCCTGATTGCTGAAGACGACGCCACCCTGGCCGACGGGCTGACCCGTTCGTTGCGCCAGGCCGGCTATGCCGT
CGACCGGGCCGCGGACGGCGCCGCCGCCGACGCGGCCCTTTCCGCGCAGACCGCGCAAACCTACGACCTGCTGATCCTCG
ATGTCGGGCTGCCGCGCCTGTCCGGCCTGGAAGTGCTCAAGCGGCTGCGCTCGCGCGGGGCGATGCTGCCGGTGCTGATC
CTGACCGCCGCCGACAGTGTCGACGAGCGCGTCAAGGGCCTGGACCTGGGGGCCGACGACTACATGGCCAAGCCCTTTGC
GCTGTCCGAGCTGGAGGCGCGCGTGCGGGCGCTGGTGCGGCGCGGCACCGGCGGCGGCGCCACGCTGGTCCGCCACGGGC
CGCTGGCCTTCGACCAGGTCGGACGCATCGCCTACATCCGCGACCAGATGGTGGACCTGTCGGCGCGGGAGCTCGGGCTG
CTGGAGATCCTGCTGTCGCGCGCCGGCCGGCTGGTCTCGAAGGAACAGCTGGTTGACCACCTGTGCGGCTGGGGCGAAGA
AGTCAGCAACAACGCGATCGAGGTCTACGTGCACCGCCTGCGCAAGAAGATCGAGGTGGACGGCATCCGCATCGCCACCG
TGCGCGGGCTCGGCTATTGCCTGGAACGCGTGAGCGTACCGGCTGCCGTCCATGGGTGA

Protein sequence : 
MRILIAEDDATLADGLTRSLRQAGYAVDRAADGAAADAALSAQTAQTYDLLILDVGLPRLSGLEVLKRLRSRGAMLPVLI
LTAADSVDERVKGLDLGADDYMAKPFALSELEARVRALVRRGTGGGATLVRHGPLAFDQVGRIAYIRDQMVDLSARELGL
LEILLSRAGRLVSKEQLVDHLCGWGEEVSNNAIEVYVHRLRKKIEVDGIRIATVRGLGYCLERVSVPAAVHG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
armR AAN62112.1 putative response-regulator ArmR Not tested PAGI-2(C) Protein 3e-34 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
F504_562 YP_007631581.1 two component transcriptional regulator, winged helix family BAC0638 Protein 2e-25 48
F504_562 YP_007631581.1 two component transcriptional regulator, winged helix family BAC0083 Protein 6e-31 46
F504_562 YP_007631581.1 two component transcriptional regulator, winged helix family NC_002516.2.879194.p Protein 2e-27 46
F504_562 YP_007631581.1 two component transcriptional regulator, winged helix family BAC0487 Protein 6e-33 45
F504_562 YP_007631581.1 two component transcriptional regulator, winged helix family BAC0308 Protein 5e-28 44
F504_562 YP_007631581.1 two component transcriptional regulator, winged helix family BAC0197 Protein 6e-28 43
F504_562 YP_007631581.1 two component transcriptional regulator, winged helix family BAC0347 Protein 1e-28 41
F504_562 YP_007631581.1 two component transcriptional regulator, winged helix family BAC0111 Protein 2e-26 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
F504_562 YP_007631581.1 two component transcriptional regulator, winged helix family VFG0473 Protein 4e-32 46
F504_562 YP_007631581.1 two component transcriptional regulator, winged helix family VFG1390 Protein 7e-30 45