
|
Name : ETAC_13010 (ETAC_13010) Accession : YP_007630083.1 Strain : Edwardsiella tarda C07-087 Genome accession: NC_020796 Putative virulence/resistance : Virulence Product : hypothetical protein Function : - COG functional category : - COG ID : - EC number : - Position : 2927331 - 2927528 bp Length : 198 bp Strand : - Note : COG3311 Predicted transcriptional regulator DNA sequence : ATGAGTCAATCATTAATTCGATTATCAGAGGTTCAACGCCGCACTGGCTATAGTAAGGCGTGGATCTACCGCTTGCTAAA AGAGAACCGCTTCCCCCAGTCGATAAAGATTGGATCACGCTCTATCGCATTTGTAGAGAGCGAGGTAGACGACTGGATTA ATCAGCGCATCGCTGAATCGCGCGGGGAGGTGGCTTAA Protein sequence : MSQSLIRLSEVQRRTGYSKAWIYRLLKENRFPQSIKIGSRSIAFVESEVDDWINQRIAESRGEVA |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| unnamed | CAB46594.1 | DNA-binding protein | Not tested | HPI | Protein | 2e-08 | 48 |
| unnamed | CAA21398.1 | - | Not tested | HPI | Protein | 3e-08 | 48 |
| VC1809 | NP_231443.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 4e-09 | 46 |
| VC0395_A1406 | YP_001217349.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 4e-09 | 46 |
| VPI2_0041 | ACA01856.1 | predicted transcriptional regulator | Not tested | VPI-2 | Protein | 2e-09 | 46 |
| VPI2_0033 | AAX20900.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 6e-07 | 46 |
| VC1785 | NP_231420.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 9e-07 | 46 |
| VC0395_A1382 | YP_001217325.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 9e-07 | 46 |
| PMI2608 | YP_002152324.1 | prophage regulatory protein | Not tested | Not named | Protein | 9e-07 | 45 |
| unnamed | CAD33739.1 | hypothetical protein | Not tested | PAI I 536 | Protein | 2e-07 | 43 |
| c5192 | NP_757040.1 | hypothetical protein | Not tested | PAI II CFT073 | Protein | 2e-07 | 43 |
| Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
| ETAC_13010 | YP_007630083.1 | hypothetical protein | VFG1141 | Protein | 1e-09 | 46 |
| ETAC_13010 | YP_007630083.1 | hypothetical protein | VFG1118 | Protein | 2e-07 | 46 |
| ETAC_13010 | YP_007630083.1 | hypothetical protein | VFG1480 | Protein | 7e-08 | 43 |