Gene Information

Name : ETAC_08080 (ETAC_08080)
Accession : YP_007629097.1
Strain : Edwardsiella tarda C07-087
Genome accession: NC_020796
Putative virulence/resistance : Unknown
Product : IS629 orfA
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1839933 - 1840265 bp
Length : 333 bp
Strand : +
Note : COG2963 Transposase and inactivated derivatives

DNA sequence :
ATGACATCGACATCATCCAAGCGTTATTCTCCCGAGCTCCGTGAGCGAGCTGTCAGAATGCTGATAGAACAGCGGGAGAG
TTACCCTTCTGAACATGCTGCCATCAAATCCATTGCTCCTAAAATCGGCTGTAGCATCGACACCCTACGCTATTGGCTTC
GCCAGCATGAACGCGATGTTGGCGGCGGTGATGCTGGACTTAAGACTGCCGAACGCCAACGGCTGAAGGCGTTGGAGCGG
GAGGTTAGAGAACGTCGACGCAGCAACGATATCCTGCGGCAGGCCTCTGCTTATTTTGCGAAGGCGGAGTTCGACCGTCT
GTGGAAAAAATAA

Protein sequence :
MTSTSSKRYSPELRERAVRMLIEQRESYPSEHAAIKSIAPKIGCSIDTLRYWLRQHERDVGGGDAGLKTAERQRLKALER
EVRERRRSNDILRQASAYFAKAEFDRLWKK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
r13 AAC61722.1 R13 Not tested PAI I CFT073 Protein 5e-28 74
Z1661 NP_287163.1 hypothetical protein Not tested TAI Protein 1e-32 74
c5177 NP_757025.1 hypothetical protein Not tested PAI II CFT073 Protein 7e-28 74
unnamed AAL67404.1 R13-like protein Not tested PAI II CFT073 Protein 5e-28 74
ECUMN_3344 YP_002414020.1 transposase ORF A, IS629 Not tested Not named Protein 7e-28 74
c5168 NP_757016.1 hypothetical protein Not tested PAI II CFT073 Protein 2e-27 74
unnamed AAF09023.1 unknown Not tested SHI-O Protein 1e-27 74
c5214 NP_757062.1 hypothetical protein Not tested PAI II CFT073 Protein 2e-27 74
tnpE AAD44738.1 TnpE Not tested SHI-2 Protein 1e-27 74
Z1199 NP_286734.1 hypothetical protein Not tested TAI Protein 1e-32 74
S3184 NP_838467.1 IS629 orfA Not tested SHI-1 Protein 2e-27 74
unnamed AAL67399.1 TnpE-like protein Not tested PAI II CFT073 Protein 1e-27 74
Z1222 NP_286757.1 hypothetical protein Not tested TAI Protein 1e-32 74
SF2979 NP_708753.1 IS629 ORF1 Not tested SHI-1 Protein 2e-27 74
unnamed ADD91740.1 hypothetical protein Not tested PAI-I AL862 Protein 1e-27 74
Z1639 NP_287142.1 hypothetical protein Not tested TAI Protein 1e-32 74
c3596 NP_755471.1 hypothetical protein Not tested PAI I CFT073 Protein 7e-28 74
ECO103_3584 YP_003223442.1 IS629 transposase OrfA Not tested LEE Protein 6e-33 73
S4062 NP_839231.1 IS629 orfA Not tested SHI-2 Protein 9e-26 73
IS629 CAC37925.1 hypothetical protein Not tested LEE Protein 4e-33 73
ECO111_3720 YP_003236060.1 putative IS629 transposase OrfA Not tested LEE Protein 1e-29 73
SF3706 NP_709445.1 IS629 ORF1 Not tested SHI-2 Protein 1e-26 73
ECO111_3775 YP_003236110.1 putative IS629 transposase OrfA Not tested LEE Protein 1e-29 73
IS629 CAI43820.1 hypothetical protein Not tested LEE Protein 4e-33 73
Z4335 NP_289560.1 hypothetical protein Not tested OI-122 Protein 1e-29 73
IS629 CAI43841.1 hypothetical protein Not tested LEE Protein 4e-33 73
IS629 CAI43908.1 hypothetical protein 1 Not tested LEE Protein 4e-33 73
APECO1_3498 YP_854313.1 transposase; OrfA protein of insertion sequence IS629 Not tested PAI I APEC-O1 Protein 1e-24 73
ORF_36 AAZ04445.1 conserved hypothetical protein Not tested PAI I APEC-O1 Protein 7e-25 73
unnamed CAD42084.1 hypothetical protein Not tested PAI II 536 Protein 7e-26 72

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ETAC_08080 YP_007629097.1 IS629 orfA VFG0643 Protein 5e-28 74
ETAC_08080 YP_007629097.1 IS629 orfA VFG1717 Protein 2e-28 74
ETAC_08080 YP_007629097.1 IS629 orfA VFG0606 Protein 4e-27 73
ETAC_08080 YP_007629097.1 IS629 orfA VFG1603 Protein 3e-26 72