Gene Information

Name : ETAC_07875 (ETAC_07875)
Accession : YP_007629056.1
Strain : Edwardsiella tarda C07-087
Genome accession: NC_020796
Putative virulence/resistance : Unknown
Product : hypothetical protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1791197 - 1791514 bp
Length : 318 bp
Strand : +
Note : COG2963 Transposase and inactivated derivatives

DNA sequence :
ATGCTCAAAACTCGTCGAACTAAACGCACCTTTTCCCCGGAGTTCAAGCTCGAAGCTATCGAGCAAGTGGTTAAATACCA
GCGCGATGTCAGAGAAGTCGCTCTGGCACTTGAGCTCAACCCTGACCATTTGCGCAAATGGATACGTCTGTATAAGCAAG
AACTTCAGGGTATTGAGCCCACTGGTAATGCCATTACCCCTGAACAGCGAGAAATTCAGCAGCTTAAAGCGCAGATAAAG
CGTCTTGAGATGGAAAAAGAAATCCTAAAGCAGGCTGCCGTGCTGATGAGCGAAATCCCCGGCAAGCTGTCGCGCTAA

Protein sequence :
MLKTRRTKRTFSPEFKLEAIEQVVKYQRDVREVALALELNPDHLRKWIRLYKQELQGIEPTGNAITPEQREIQQLKAQIK
RLEMEKEILKQAAVLMSEIPGKLSR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42047.1 hypothetical protein Not tested PAI II 536 Protein 2e-41 95
unnamed CAD33780.1 putative transposase Not tested PAI I 536 Protein 9e-42 92
orfA AGK06994.1 IS1359 transposase; OrfA Not tested SGI1 Protein 1e-13 44
orfA AGK07052.1 IS1359 transposase; OrfA Not tested SGI1 Protein 1e-13 44
orfA ACX47959.1 IS1359 transposase; OrfA Not tested SGI1 Protein 1e-13 44
VC1790 NP_231425.1 transposase OrfAB subunit A Not tested VPI-2 Protein 2e-13 44
VPI2_0009c ACA01826.1 transposase OrfAB subunit A Not tested VPI-2 Protein 1e-13 44
orfA YP_001217330.1 transposase OrfAB subunit A Not tested VPI-2 Protein 2e-13 44
orfA AGK06911.1 IS1359 transposase; OrfA Not tested SGI1 Protein 1e-13 44
unnamed AGK06948.1 IS1359 transposase; OrfA Not tested SGI1 Protein 1e-13 44
RS05 AAP82950.1 putative transposase Not tested PAPI-2 Protein 1e-11 42
api80 CAF28554.1 putative transposase Not tested YAPI Protein 2e-11 41
unnamed ACU09431.1 IS911 transposase orfA Not tested LEE Protein 5e-14 41
l7045 CAD33744.1 - Not tested PAI I 536 Protein 2e-12 41
orfA CAE85179.1 OrfA protein, IS911 Not tested PAI V 536 Protein 2e-12 41
unnamed AAC31483.1 L0004 Not tested LEE Protein 1e-14 41
Z5088 NP_290240.1 hypothetical protein Not tested LEE Protein 2e-14 41
ECs4535 NP_312562.1 hypothetical protein Not tested LEE Protein 2e-14 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ETAC_07875 YP_007629056.1 hypothetical protein VFG1566 Protein 8e-42 95
ETAC_07875 YP_007629056.1 hypothetical protein VFG1521 Protein 4e-42 92
ETAC_07875 YP_007629056.1 hypothetical protein VFG1123 Protein 5e-14 44
ETAC_07875 YP_007629056.1 hypothetical protein VFG1485 Protein 8e-13 41
ETAC_07875 YP_007629056.1 hypothetical protein VFG0784 Protein 6e-15 41