Gene Information

Name : SM2011_b21234 (SM2011_b21234)
Accession : YP_007613497.1
Strain :
Genome accession: NC_020560
Putative virulence/resistance : Unknown
Product : putative transposase of insertion sequence ISRm1 orfA protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 800001 - 800393 bp
Length : 393 bp
Strand : -
Note : corresponds to SMb21234

DNA sequence :
ATGACTAGCAGCAATTTTAAGATGGAAGTTCTCTCCGGGCCGGAACGTCGGCGGCGCTGGAGCACGGCAGAGAAGCTGGC
GATCATCCACGAGACCTATGAGGCGGACGCGACGGTGAGCATCGTCGCGCGTCGGCACGGCATCCAGCCGAACCAGTTGT
TCGCCTGGCGCAAGCTGGCGTCCCAAGGGGCACTGACGGCGACGGCCGCCGAAGAGGAGGTCGTTCCGGCTTCCGAATAC
CGGGCGCTTCAGGCCCAGGTGAAGGAGTTGCAACGCCTGTTGGGCAAGAAGACGATGGAGAGCGAAATCCTGAAGGAAGC
CCTCGAAATCGCCGGTAGCCCAAAAAAACATCTGTTGCGCTCGCTCTCTCTTCCGAGGGGGATTTTGGGATGA

Protein sequence :
MTSSNFKMEVLSGPERRRRWSTAEKLAIIHETYEADATVSIVARRHGIQPNQLFAWRKLASQGALTATAAEEEVVPASEY
RALQAQVKELQRLLGKKTMESEILKEALEIAGSPKKHLLRSLSLPRGILG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
S4060 NP_839229.2 insertion sequence 2 OrfA protein Not tested SHI-2 Protein 3e-21 60
tnpG AAD44740.1 TnpG Not tested SHI-2 Protein 2e-21 60
unnamed AAL57520.1 IS2 transposase Not tested LEE Protein 2e-21 60
st02 CAC81840.1 ST02 protein Not tested LEE II Protein 2e-21 60
ECO26_5247 YP_003232129.1 insertion sequence 2 OrfA protein Not tested LEE Protein 3e-21 60
S3188 NP_838471.2 insertion sequence 2 OrfA protein Not tested SHI-1 Protein 3e-21 60
SF2984 NP_708758.3 IS2 ORF1 Not tested SHI-1 Protein 2e-21 60
aec50 AAW51733.1 Aec50 Not tested AGI-3 Protein 2e-21 60
S4049 NP_839217.2 insertion sequence 2 OrfA protein Not tested SHI-2 Protein 1e-20 59
SF3709 NP_709448.3 IS2 ORF1 Not tested SHI-2 Protein 7e-21 59
SF3722 NP_709461.3 IS2 ORF1 Not tested SHI-2 Protein 7e-21 59
unnamed AAL67376.1 insertion sequence protein Not tested PAI II CFT073 Protein 8e-18 53
insC YP_002414034.1 IS2 insertion element repressor InsA; KpLE2 phage-like element Not tested Not named Protein 1e-17 53

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SM2011_b21234 YP_007613497.1 putative transposase of insertion sequence ISRm1 orfA protein VFG0648 Protein 6e-22 60
SM2011_b21234 YP_007613497.1 putative transposase of insertion sequence ISRm1 orfA protein VFG0622 Protein 2e-21 59
SM2011_b21234 YP_007613497.1 putative transposase of insertion sequence ISRm1 orfA protein VFG0609 Protein 2e-21 59
SM2011_b21234 YP_007613497.1 putative transposase of insertion sequence ISRm1 orfA protein VFG1733 Protein 3e-18 53