Gene Information

Name : tns (AZKH_p0196)
Accession : YP_007598136.1
Strain :
Genome accession: NC_020548
Putative virulence/resistance : Unknown
Product : transposase, IS3/IS911 family
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 210370 - 210687 bp
Length : 318 bp
Strand : +
Note : -

DNA sequence :
ATGAAGAAGACGAAGTTCTCCCCCGAAGTGCGCGAGCGGGCCGTGCGCATGGTGTTCGAGCAGCGCGACCAGCATGGATC
ACAGTGGGCGGCGATCGAATCGATCGCGGCCAAGATCGGTTGCAGCGCGCAGACGCTGTCGAACTGGGTGCGCCGGTACG
AGCGGGACACCGGGCAGCGTGATGGGGTCAGCACTGCAGAGGCGGCCCGCATCAAGGAGCTCGAGCGCGAGGTCCGCGAG
CTGAAGAAGGCCAACGAGATTCTGCGCCTTGCCAGCGCGTATTTCGCGCAGGCGGAGCTCGACCGCCGCAACAAGTGA

Protein sequence :
MKKTKFSPEVRERAVRMVFEQRDQHGSQWAAIESIAAKIGCSAQTLSNWVRRYERDTGQRDGVSTAEAARIKELEREVRE
LKKANEILRLASAYFAQAELDRRNK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
ECO103_3584 YP_003223442.1 IS629 transposase OrfA Not tested LEE Protein 9e-20 66
IS629 CAC37925.1 hypothetical protein Not tested LEE Protein 6e-20 66
IS629 CAI43820.1 hypothetical protein Not tested LEE Protein 6e-20 66
IS629 CAI43841.1 hypothetical protein Not tested LEE Protein 6e-20 66
IS629 CAI43908.1 hypothetical protein 1 Not tested LEE Protein 6e-20 66
Z1199 NP_286734.1 hypothetical protein Not tested TAI Protein 2e-19 66
Z1222 NP_286757.1 hypothetical protein Not tested TAI Protein 2e-19 66
Z1639 NP_287142.1 hypothetical protein Not tested TAI Protein 2e-19 66
Z1661 NP_287163.1 hypothetical protein Not tested TAI Protein 2e-19 66
unnamed CAD42084.1 hypothetical protein Not tested PAI II 536 Protein 5e-17 64
APECO1_3498 YP_854313.1 transposase; OrfA protein of insertion sequence IS629 Not tested PAI I APEC-O1 Protein 2e-16 64
ECO111_3720 YP_003236060.1 putative IS629 transposase OrfA Not tested LEE Protein 5e-18 64
ECO111_3775 YP_003236110.1 putative IS629 transposase OrfA Not tested LEE Protein 5e-18 64
Z4335 NP_289560.1 hypothetical protein Not tested OI-122 Protein 5e-18 64
ORF_36 AAZ04445.1 conserved hypothetical protein Not tested PAI I APEC-O1 Protein 2e-16 64
unnamed AAL67399.1 TnpE-like protein Not tested PAI II CFT073 Protein 4e-16 62
c5168 NP_757016.1 hypothetical protein Not tested PAI II CFT073 Protein 5e-16 62
unnamed ADD91740.1 hypothetical protein Not tested PAI-I AL862 Protein 4e-16 62
c5214 NP_757062.1 hypothetical protein Not tested PAI II CFT073 Protein 5e-16 62
unnamed AAF09023.1 unknown Not tested SHI-O Protein 4e-16 62
S3184 NP_838467.1 IS629 orfA Not tested SHI-1 Protein 5e-16 62
tnpE AAD44738.1 TnpE Not tested SHI-2 Protein 4e-16 62
SF2979 NP_708753.1 IS629 ORF1 Not tested SHI-1 Protein 5e-16 62
c5177 NP_757025.1 hypothetical protein Not tested PAI II CFT073 Protein 1e-14 61
ECUMN_3344 YP_002414020.1 transposase ORF A, IS629 Not tested Not named Protein 1e-14 61
r13 AAC61722.1 R13 Not tested PAI I CFT073 Protein 9e-15 61
unnamed AAL67404.1 R13-like protein Not tested PAI II CFT073 Protein 9e-15 61
S4062 NP_839231.1 IS629 orfA Not tested SHI-2 Protein 9e-15 61
c3596 NP_755471.1 hypothetical protein Not tested PAI I CFT073 Protein 1e-14 61
SF3706 NP_709445.1 IS629 ORF1 Not tested SHI-2 Protein 4e-16 61

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
tns YP_007598136.1 transposase, IS3/IS911 family VFG1603 Protein 2e-17 64
tns YP_007598136.1 transposase, IS3/IS911 family VFG0643 Protein 1e-16 62
tns YP_007598136.1 transposase, IS3/IS911 family VFG1717 Protein 4e-15 61
tns YP_007598136.1 transposase, IS3/IS911 family VFG0606 Protein 1e-16 61