Gene Information

Name : G432_19350 (G432_19350)
Accession : YP_007592281.1
Strain :
Genome accession: NC_020542
Putative virulence/resistance : Resistance
Product : mercuric resistance operon regulatory protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 34818 - 35240 bp
Length : 423 bp
Strand : -
Note : COG0789 Predicted transcriptional regulators

DNA sequence :
ATGGAGCAACAGGTCGGCATCTTGCGTGCCCAGCTTGCCCGGAAAACAGGCTGCAATCTCGAAACCATCCGCTATTACGA
GAAGGTGGGATTGCTGCCGGGGCCGCCTCGCAGTTCCAACGGCTACCGCGTCTATTCGCCGGAACTGGTGCAAAGGTTGC
AGTTCATCCTGCGCGCGCGCGACCTTGGCTATGCAATGGATGAGATACGGTCATTGTTGTCGCTCACCGATACCGGTGCA
CAAACCTGCGCGGAGGTTATGGCGAGAACCGAACTCCACCTTGAAGATGTCCGCCGCCGCATTGCAGATTTGCAGAAGAT
AGAGGTGACGCTGGCGACCACGTTAGCCAGATGCACTGGAGATGACGTTGCCGAATGTCCCATCCTGGAAGCACTCCAGT
TTTTACCCCATCAAGGCAATTGA

Protein sequence :
MEQQVGILRAQLARKTGCNLETIRYYEKVGLLPGPPRSSNGYRVYSPELVQRLQFILRARDLGYAMDEIRSLLSLTDTGA
QTCAEVMARTELHLEDVRRRIADLQKIEVTLATTLARCTGDDVAECPILEALQFLPHQGN

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
ACICU_00234 YP_001844893.1 transcriptional regulator Not tested AbaR20 Protein 3e-20 42
cadR ADZ05769.1 MerR family transcriptional regulator Not tested AbaR11 Protein 3e-20 42
cadR ACS32041.1 MerR family transcriptional regulator Not tested AbaR5 Protein 4e-20 42
pbrR CAJ77021.1 transcription regulator Not tested AbaR1 Protein 3e-20 42
pbrR CAJ77094.1 Transcriptional regulator Not tested AbaR1 Protein 2e-20 42
cadR AGK36653.1 MerR family transcriptional regulator Not tested AbaR26 Protein 2e-20 42
cadR ACN81029.1 MerR family transcriptional regulator Not tested AbaR5 Protein 3e-20 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
G432_19350 YP_007592281.1 mercuric resistance operon regulatory protein BAC0682 Protein 3e-25 46
G432_19350 YP_007592281.1 mercuric resistance operon regulatory protein BAC0301 Protein 2e-20 44
G432_19350 YP_007592281.1 mercuric resistance operon regulatory protein BAC0058 Protein 3e-23 44
G432_19350 YP_007592281.1 mercuric resistance operon regulatory protein BAC0182 Protein 6e-24 41