Gene Information

Name : R2APBS1_2107 (R2APBS1_2107)
Accession : YP_007590463.1
Strain : Rhodanobacter sp. 2APBS1
Genome accession: NC_020541
Putative virulence/resistance : Resistance
Product : Hg(II)-responsive transcriptional regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2257766 - 2258173 bp
Length : 408 bp
Strand : +
Note : PFAM: MerR family regulatory protein; MerR, DNA binding; TIGRFAM: Hg(II)-responsive transcriptional regulator

DNA sequence :
ATGGGGAAGCCATCGGAACAACTGACCATCGGTGCGTTTGCCAAAGCCGCGGGGGTCAACCTGGAAACCATCCGGTTTTA
TCAGCGCAAGGGGCTGCTTCCGGAACCGGACAAACCCTATGGCAGCATCCGCCGCTATGGTGATACCGATGTCGCTCGTG
TGAAATTCATCAAGTCAGCGCAGCGTTTGGGCTTCAGCCTCGACGAAGTCGCACAGTTGCTCGCCCTGGAGGACGGCACC
CATTGCAGTGAGGCGGCACAATTCGCCGCGCAGCACCTGGCCGACGTGCGGGGACGCCTGAAAGACCTCAAGCGCATGGA
AACCGTACTGGCTCGATTGGTCGCGCAATGTCATTCGCATCGCGGCACCATTACCTGCCCCCTCATCGCCTCCCTGCATG
GCCGTTGA

Protein sequence :
MGKPSEQLTIGAFAKAAGVNLETIRFYQRKGLLPEPDKPYGSIRRYGDTDVARVKFIKSAQRLGFSLDEVAQLLALEDGT
HCSEAAQFAAQHLADVRGRLKDLKRMETVLARLVAQCHSHRGTITCPLIASLHGR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merR AAN62181.1 organomercurial resistance regulatory protein MerR Not tested PAGI-2(C) Protein 4e-46 72
merR CAJ77064.1 Mercury resistance operon regulatory protein Not tested AbaR1 Protein 7e-46 72
merR ACN81009.1 MerR activator/repressor of mer operon Not tested AbaR5 Protein 1e-45 72
unnamed ABR13397.1 mercuric resistance operon regulatory protein Not tested PAGI-5 Protein 4e-45 71
merR ACK44535.1 MerR Not tested SGI1 Protein 3e-46 71
merR AET25401.1 MerR Not tested PAGI-2(C) Protein 3e-46 71
merR YP_006098391.1 mercuric resistance operon transcriptional regulator Not tested Tn2411 Protein 4e-46 71
merR AFG30124.1 MerR Not tested PAGI-2 Protein 3e-46 71
merR AGK07025.1 MerR Not tested SGI1 Protein 1e-45 70
merR AGK07083.1 MerR Not tested SGI1 Protein 1e-45 70
EXB37 ABD94723.1 putative regulator of mercury resistance conferring proteins Not tested ExoU island B Protein 4e-27 47

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
R2APBS1_2107 YP_007590463.1 Hg(II)-responsive transcriptional regulator BAC0687 Protein 2e-46 71
R2APBS1_2107 YP_007590463.1 Hg(II)-responsive transcriptional regulator BAC0683 Protein 2e-47 71
R2APBS1_2107 YP_007590463.1 Hg(II)-responsive transcriptional regulator BAC0686 Protein 2e-47 71
R2APBS1_2107 YP_007590463.1 Hg(II)-responsive transcriptional regulator BAC0232 Protein 2e-46 71
R2APBS1_2107 YP_007590463.1 Hg(II)-responsive transcriptional regulator BAC0684 Protein 7e-47 71
R2APBS1_2107 YP_007590463.1 Hg(II)-responsive transcriptional regulator BAC0688 Protein 2e-47 70
R2APBS1_2107 YP_007590463.1 Hg(II)-responsive transcriptional regulator BAC0689 Protein 5e-45 68