Gene Information

Name : R2APBS1_2096 (R2APBS1_2096)
Accession : YP_007590452.1
Strain : Rhodanobacter sp. 2APBS1
Genome accession: NC_020541
Putative virulence/resistance : Resistance
Product : mercuric resistance transcriptional repressor protein MerD
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2251087 - 2251452 bp
Length : 366 bp
Strand : -
Note : PFAM: MerR family regulatory protein; TIGRFAM: mercuric resistence transcriptional repressor protein MerD

DNA sequence :
ATGAACGCCTACACCGTGTCACAGCTGGCTAAAGACGCCGGCGTGAGCGTGCATATCGTGCGTGACTACCTGGTGCGCGG
GCTGCTGCATCCGGCCGCGCGCACCGATGGAGGTTATGGCGTGTTCGACGCGAACGCCCTGCACCGGCTTTGTTTCGTGC
GGTCCGCGGTCGAGGCAGGGGTCGGCCTGGACGTCGTGACGCGACTGTGCCGGTCGCTGGATGCATCGAATGCCGATAAG
ACGGTGATGTGCCTGGCAGAGGTAGGCGGAATCGTCGATGAGCGGCGGCAGGCATTGGTGGGGTTGGAGGCGCAATTGAG
CGCGCTGCGGGCAGAGGTTGGTCGACACGAAGAGGCACGGCGATGA

Protein sequence :
MNAYTVSQLAKDAGVSVHIVRDYLVRGLLHPAARTDGGYGVFDANALHRLCFVRSAVEAGVGLDVVTRLCRSLDASNADK
TVMCLAEVGGIVDERRQALVGLEAQLSALRAEVGRHEEARR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merD AET25396.1 MerD Not tested PAGI-2(C) Protein 8e-27 62
merD AFG30119.1 MerD Not tested PAGI-2 Protein 8e-27 62
merD AGK07020.1 MerD Not tested SGI1 Protein 6e-28 62
merD AGK07078.1 MerD Not tested SGI1 Protein 6e-28 62
merD YP_006098386.1 MerR family transcriptional regulator Not tested Tn2411 Protein 1e-26 62
merD ACF06181.1 mercuric resistance protein Not tested Tn5036-like Protein 8e-27 62
merD ABQ57370.1 MerD Not tested SGI1 Protein 1e-27 61
merD ACN81004.1 MerD Not tested AbaR5 Protein 6e-30 60
merD CAJ77059.1 Mercury operon coregulator protein Not tested AbaR1 Protein 1e-29 60

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
R2APBS1_2096 YP_007590452.1 mercuric resistance transcriptional repressor protein MerD BAC0668 Protein 3e-28 62
R2APBS1_2096 YP_007590452.1 mercuric resistance transcriptional repressor protein MerD BAC0667 Protein 1e-30 62
R2APBS1_2096 YP_007590452.1 mercuric resistance transcriptional repressor protein MerD BAC0666 Protein 4e-28 61
R2APBS1_2096 YP_007590452.1 mercuric resistance transcriptional repressor protein MerD BAC0227 Protein 5e-28 61
R2APBS1_2096 YP_007590452.1 mercuric resistance transcriptional repressor protein MerD BAC0665 Protein 4e-27 59
R2APBS1_2096 YP_007590452.1 mercuric resistance transcriptional repressor protein MerD BAC0669 Protein 4e-29 58