Gene Information

Name : R2APBS1_2095 (R2APBS1_2095)
Accession : YP_007590451.1
Strain : Rhodanobacter sp. 2APBS1
Genome accession: NC_020541
Putative virulence/resistance : Resistance
Product : MerE protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2250872 - 2251090 bp
Length : 219 bp
Strand : -
Note : PFAM: MerE protein

DNA sequence :
ATGAACGGTCACGAGCGCAAATCCATCACGGGTTACCTGTGGGCCGGGCTGGCTGTGCTGACGTGCCCGTGTCACCTCCC
GATCCTGGCCGCGCTCTTGGCGGGTACGACGGCCGGCGCCTTTTTCAGTGCGCACTGGGTCATCGCGGCACTGGGGTTGA
TCAGCTTGTTCGGGCTATCCGTGTGGCGGGCGATACGTGCGTTTGGAGGACGCGTATGA

Protein sequence :
MNGHERKSITGYLWAGLAVLTCPCHLPILAALLAGTTAGAFFSAHWVIAALGLISLFGLSVWRAIRAFGGRV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merE ABQ57369.1 MerE Not tested SGI1 Protein 3e-15 71
merE AGK07019.1 MerE Not tested SGI1 Protein 3e-15 71
merE AGK07077.1 MerE Not tested SGI1 Protein 3e-15 71
merE ACN81003.1 MerE Not tested AbaR5 Protein 3e-14 68
merE CAJ77058.1 Hypothetical protein Not tested AbaR1 Protein 2e-14 68
merE ACF06180.1 mercuric resistance protein Not tested Tn5036-like Protein 2e-13 63
merE AET25395.1 MerE Not tested PAGI-2(C) Protein 2e-13 63
merE AFG30118.1 MerE Not tested PAGI-2 Protein 2e-13 63
merE YP_006098385.1 putative mercury resistance protein Not tested Tn2411 Protein 3e-13 63

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
R2APBS1_2095 YP_007590451.1 MerE protein BAC0673 Protein 1e-15 71
R2APBS1_2095 YP_007590451.1 MerE protein BAC0671 Protein 1e-15 71
R2APBS1_2095 YP_007590451.1 MerE protein BAC0670 Protein 4e-14 67
R2APBS1_2095 YP_007590451.1 MerE protein BAC0672 Protein 1e-13 65