Gene Information

Name : R2APBS1_1855 (R2APBS1_1855)
Accession : YP_007590214.1
Strain : Rhodanobacter sp. 2APBS1
Genome accession: NC_020541
Putative virulence/resistance : Resistance
Product : mercuric transport protein periplasmic component
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2012900 - 2013178 bp
Length : 279 bp
Strand : -
Note : PFAM: Heavy-metal-associated domain; TIGRFAM: mercuric transport protein periplasmic component

DNA sequence :
ATGAAGAAACTTGCCGCTCTCATCGTCCTTGCCACCGCCATTTCCGCGCCTGCCTGGGCGGCTACGAAGACCGCCACCCT
GTCGGTGTCCGGTATGACGTGTGCCGCATGTCCCATCACCGTCAAGAAAGCGCTGTCCCAGGTTCCCGGTGTCGAAAAGA
CCGAGATCCTGTTCGACAAGAAGGAAGCCGTTGTGACCTTCGATGATGCCAAGACCAGCACCCGGGCACTCGTCAGCGCC
ACGACGGATGCGGGCTACCCCTCCACCGTTAAGAATTGA

Protein sequence :
MKKLAALIVLATAISAPAWAATKTATLSVSGMTCAACPITVKKALSQVPGVEKTEILFDKKEAVVTFDDAKTSTRALVSA
TTDAGYPSTVKN

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ABR13399.1 copper-transporting ATPase 2 Not tested PAGI-5 Protein 7e-19 72
merP AFG30122.1 MerP Not tested PAGI-2 Protein 1e-17 69
merP AGK07023.1 MerP Not tested SGI1 Protein 1e-17 69
merP AGK07081.1 MerP Not tested SGI1 Protein 1e-17 69
merP ACN81007.1 MerP periplasmic mercuric ion binding protein Not tested AbaR5 Protein 3e-17 69
merP YP_006098389.1 mercuric ion transport protein Not tested Tn2411 Protein 1e-17 69
merP CAJ77062.1 Periplasmic mercuric ion binding protein Not tested AbaR1 Protein 2e-17 69
merP ABQ57373.1 MerP Not tested SGI1 Protein 1e-17 69
merP AET25399.1 MerP Not tested PAGI-2(C) Protein 1e-17 69

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
R2APBS1_1855 YP_007590214.1 mercuric transport protein periplasmic component BAC0679 Protein 1e-17 70
R2APBS1_1855 YP_007590214.1 mercuric transport protein periplasmic component BAC0231 Protein 3e-17 69
R2APBS1_1855 YP_007590214.1 mercuric transport protein periplasmic component BAC0675 Protein 4e-16 69
R2APBS1_1855 YP_007590214.1 mercuric transport protein periplasmic component BAC0678 Protein 1e-17 67
R2APBS1_1855 YP_007590214.1 mercuric transport protein periplasmic component BAC0674 Protein 2e-14 60