Gene Information

Name : R2APBS1_1725 (R2APBS1_1725)
Accession : YP_007590090.1
Strain : Rhodanobacter sp. 2APBS1
Genome accession: NC_020541
Putative virulence/resistance : Resistance
Product : putative transcriptional regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1882372 - 1882770 bp
Length : 399 bp
Strand : -
Note : PFAM: MerR, DNA binding; MerR family regulatory protein; TIGRFAM: Hg(II)-responsive transcriptional regulator

DNA sequence :
ATGAATTCTGCTCTCACTATCGGTCGGTTGGCTTTGGCCGCTGACGTGCACGTCGAAACTGTGCGCTACTACCAGCGTGT
GGGCCTGTTGCATGAGCCCGAGCGGCCCCTAGGCGGCGTGCGCCGCTATGAACATCATGATCTGGCGCGCCTGCAATTCA
TCCGCCGCGCCAAGACCATGGGCTTCACGCTGGAGGAGATCGCCGGACTGCTGCAGCTCAAAGGTAAACGGGCCTGTGCG
CAGACACGCCGACTGATCGAGCACAAGCTTTTCGATGTGCGCCGCAAGTTGGAGGAACTGCGACGACTGGAGGCGGAACT
CGTACAACTCGCCGGTGACTGCGCACAGACACCTCGTGACGGTCACTGTCCGACACTGGATTTCCTTCGGCAGGCATAG

Protein sequence :
MNSALTIGRLALAADVHVETVRYYQRVGLLHEPERPLGGVRRYEHHDLARLQFIRRAKTMGFTLEEIAGLLQLKGKRACA
QTRRLIEHKLFDVRRKLEELRRLEAELVQLAGDCAQTPRDGHCPTLDFLRQA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ABR13397.1 mercuric resistance operon regulatory protein Not tested PAGI-5 Protein 1e-22 50
EXB37 ABD94723.1 putative regulator of mercury resistance conferring proteins Not tested ExoU island B Protein 8e-23 46
merR AFG30124.1 MerR Not tested PAGI-2 Protein 5e-21 45
merR YP_006098391.1 mercuric resistance operon transcriptional regulator Not tested Tn2411 Protein 7e-21 45
merR AGK07025.1 MerR Not tested SGI1 Protein 6e-21 45
merR AGK07083.1 MerR Not tested SGI1 Protein 6e-21 45
merR ACK44535.1 MerR Not tested SGI1 Protein 5e-21 45
merR AET25401.1 MerR Not tested PAGI-2(C) Protein 5e-21 45
merR CAJ77064.1 Mercury resistance operon regulatory protein Not tested AbaR1 Protein 4e-21 45
merR ACN81009.1 MerR activator/repressor of mer operon Not tested AbaR5 Protein 6e-21 45
merR AAN62181.1 organomercurial resistance regulatory protein MerR Not tested PAGI-2(C) Protein 6e-19 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
R2APBS1_1725 YP_007590090.1 putative transcriptional regulator BAC0688 Protein 8e-22 48
R2APBS1_1725 YP_007590090.1 putative transcriptional regulator BAC0687 Protein 4e-21 45
R2APBS1_1725 YP_007590090.1 putative transcriptional regulator BAC0232 Protein 4e-21 45
R2APBS1_1725 YP_007590090.1 putative transcriptional regulator BAC0684 Protein 2e-21 45
R2APBS1_1725 YP_007590090.1 putative transcriptional regulator BAC0683 Protein 2e-21 45
R2APBS1_1725 YP_007590090.1 putative transcriptional regulator BAC0686 Protein 2e-21 45
R2APBS1_1725 YP_007590090.1 putative transcriptional regulator BAC0689 Protein 7e-20 45