Gene Information

Name : feuP (SM2011_c00458)
Accession : YP_007574278.1
Strain : Sinorhizobium meliloti 2011
Genome accession: NC_020528
Putative virulence/resistance : Virulence
Product : Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1104979 - 1105650 bp
Length : 672 bp
Strand : +
Note : corresponds to SMc00458

DNA sequence :
ATGCGCATTCTGATCGTCGAGGACGATACCAATCTGAACAGGCAGCTGGCTGACGCTCTGAAGGAGGCCGGTTATGTCGT
CGACCAGGCTTATGACGGCGAAGAGGGCCACTATCTAGGCGATGCGGAGCCCTATGATGCGGTAATTCTCGATATAGGTC
TTCCGGAGATGGACGGCATCACCGTTCTCGAGAAATGGCGCGCAGACGGCAAGACCATGCCGGTGCTGATCCTGACGGCC
CGCGATCGATGGAGCGACAAGGTCGCAGGCATCGATGCCGGCGCCGACGATTATGTGGCGAAGCCTTTCCACGTCGAGGA
GGTGCTGGCCCGCATCCGTGCGTTGATCCGGCGGGCCGCCGGGCACGCAAGCTCCGAGATCGTCTGCGGCCCCGTCCGTC
TCGACACCAAGGGCTCCAAGGCGACCGTCGCTGGCGTCGCGCTGAAGCTCACATCGCACGAGTTCCGTCTGCTTTCCTAC
CTCATGCACCATATGGGACAGGTGGTTTCCCGCACCGAGTTGGTCGAACACATGTATGATCAGGACTTCGATCGCGATTC
CAACACGATCGAGGTTTTCATCGGCCGGCTCCGTAAGAAGATCGGCAACGATCTGATCGAAACGGTGCGCGGCCTCGGAT
ATCGCATGCAAGCACCCGGCAATGGCCATTAG

Protein sequence :
MRILIVEDDTNLNRQLADALKEAGYVVDQAYDGEEGHYLGDAEPYDAVILDIGLPEMDGITVLEKWRADGKTMPVLILTA
RDRWSDKVAGIDAGADDYVAKPFHVEEVLARIRALIRRAAGHASSEIVCGPVRLDTKGSKATVAGVALKLTSHEFRLLSY
LMHHMGQVVSRTELVEHMYDQDFDRDSNTIEVFIGRLRKKIGNDLIETVRGLGYRMQAPGNGH

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-27 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-26 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
feuP YP_007574278.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain protein NC_002516.2.879194.p Protein 1e-38 47
feuP YP_007574278.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain protein CP000647.1.gene1136. Protein 7e-37 46
feuP YP_007574278.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain protein BAC0530 Protein 7e-37 46
feuP YP_007574278.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain protein CP001918.1.gene2526. Protein 3e-36 45
feuP YP_007574278.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain protein CP004022.1.gene1005. Protein 3e-40 45
feuP YP_007574278.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain protein BAC0487 Protein 3e-28 45
feuP YP_007574278.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain protein CP001138.1.gene1939. Protein 9e-37 44
feuP YP_007574278.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain protein CP000034.1.gene2022. Protein 8e-37 43
feuP YP_007574278.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain protein NC_002695.1.913289.p Protein 3e-36 43
feuP YP_007574278.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain protein BAC0347 Protein 3e-28 42
feuP YP_007574278.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain protein BAC0111 Protein 8e-32 42
feuP YP_007574278.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain protein BAC0197 Protein 4e-30 42
feuP YP_007574278.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain protein BAC0125 Protein 1e-29 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
feuP YP_007574278.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain protein VFG0475 Protein 8e-37 44
feuP YP_007574278.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain protein VFG0473 Protein 2e-28 43
feuP YP_007574278.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain protein VFG0596 Protein 7e-28 42
feuP YP_007574278.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain protein VFG1389 Protein 3e-28 41