Gene Information

Name : YM304_38610 (YM304_38610)
Accession : YP_007566113.1
Strain : Ilumatobacter coccineum YM16-304
Genome accession: NC_020520
Putative virulence/resistance : Virulence
Product : putative OmpR family two-component response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 4354483 - 4355172 bp
Length : 690 bp
Strand : -
Note : -

DNA sequence :
ATGACGGGAACAAAGGTCTTGGTCGTTGACGACGAACCCACGGTGCGCGAGGTCGTCGTCGGGTACCTGCGCCGCGACGG
GCACGACGTCGCCGAGGCCGCCGACGGCCACACCGCCCTCGAACTGCTCGAGGCAGAACCCCCCGACCTCGTGGTGCTCG
ACATGATGCTTCCCGGAGTCAACGGACTCGACATCCTCCGCCGCGTCCGATCGACGAGCGACATCCCCGTCATCATGCTC
ACCGCTCGCGCCGAGGAGTCCGATCGAGTCGCCGGACTCGAACTGGGTGCCGACGACTACGTCGTCAAACCGTTCTCACC
ACGCGAACTCGCTGCTCGGGTCAACGGCGTGCTGCGTCGCTCCTCGGCGCGCGACACCAACGCACCACAGTCGTTGGAGT
TCGACGGGCTGTTCGTCGATCCGCTCAGCCGGGAGGTCAAACTCCACGGCGAGATCGTCGACATGACCCCCAAGGAGTTC
GACGTCCTCGCGTTCCTCGCCAGCTCGCCGCGGCAGGTCTTCTCGCGCGCCCAACTGCTCGAGCAGGTCTGGCAGTCATC
GCCCGAGTGGCAGGACCCCGCCACCGTCACCGTGCACGTCCGGCGCATCCGCAACAAGATCGAAGCCGACCCCGAGAAGC
CACGCTGGATCACCACGGTGTGGGGAGTCGGCTACCGGTTCGAACCGTGA

Protein sequence :
MTGTKVLVVDDEPTVREVVVGYLRRDGHDVAEAADGHTALELLEAEPPDLVVLDMMLPGVNGLDILRRVRSTSDIPVIML
TARAEESDRVAGLELGADDYVVKPFSPRELAARVNGVLRRSSARDTNAPQSLEFDGLFVDPLSREVKLHGEIVDMTPKEF
DVLAFLASSPRQVFSRAQLLEQVWQSSPEWQDPATVTVHVRRIRNKIEADPEKPRWITTVWGVGYRFEP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 3e-36 45
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 5e-35 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
YM304_38610 YP_007566113.1 putative OmpR family two-component response regulator NC_012469.1.7685629. Protein 9e-38 45
YM304_38610 YP_007566113.1 putative OmpR family two-component response regulator AE000516.2.gene3505. Protein 2e-34 45
YM304_38610 YP_007566113.1 putative OmpR family two-component response regulator NC_002952.2859905.p0 Protein 6e-35 43
YM304_38610 YP_007566113.1 putative OmpR family two-component response regulator NC_009641.5332272.p0 Protein 6e-35 43
YM304_38610 YP_007566113.1 putative OmpR family two-component response regulator NC_013450.8614421.p0 Protein 6e-35 43
YM304_38610 YP_007566113.1 putative OmpR family two-component response regulator NC_007622.3794472.p0 Protein 6e-35 43
YM304_38610 YP_007566113.1 putative OmpR family two-component response regulator NC_002745.1124361.p0 Protein 6e-35 43
YM304_38610 YP_007566113.1 putative OmpR family two-component response regulator NC_009782.5559369.p0 Protein 6e-35 43
YM304_38610 YP_007566113.1 putative OmpR family two-component response regulator NC_002951.3237708.p0 Protein 6e-35 43
YM304_38610 YP_007566113.1 putative OmpR family two-component response regulator NC_007793.3914279.p0 Protein 6e-35 43
YM304_38610 YP_007566113.1 putative OmpR family two-component response regulator NC_002758.1121668.p0 Protein 6e-35 43
YM304_38610 YP_007566113.1 putative OmpR family two-component response regulator NC_003923.1003749.p0 Protein 6e-35 43
YM304_38610 YP_007566113.1 putative OmpR family two-component response regulator AF162694.1.orf4.gene Protein 9e-37 42
YM304_38610 YP_007566113.1 putative OmpR family two-component response regulator HE999704.1.gene2815. Protein 1e-38 42
YM304_38610 YP_007566113.1 putative OmpR family two-component response regulator CP000034.1.gene3671. Protein 4e-34 42
YM304_38610 YP_007566113.1 putative OmpR family two-component response regulator NC_011595.7057856.p0 Protein 2e-32 41
YM304_38610 YP_007566113.1 putative OmpR family two-component response regulator NC_010410.6002989.p0 Protein 2e-32 41
YM304_38610 YP_007566113.1 putative OmpR family two-component response regulator NC_010400.5986590.p0 Protein 5e-33 41
YM304_38610 YP_007566113.1 putative OmpR family two-component response regulator BAC0197 Protein 7e-27 41
YM304_38610 YP_007566113.1 putative OmpR family two-component response regulator BAC0111 Protein 1e-27 41
YM304_38610 YP_007566113.1 putative OmpR family two-component response regulator DQ212986.1.gene4.p01 Protein 9e-34 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
YM304_38610 YP_007566113.1 putative OmpR family two-component response regulator VFG1563 Protein 2e-36 45
YM304_38610 YP_007566113.1 putative OmpR family two-component response regulator VFG1702 Protein 2e-35 44
YM304_38610 YP_007566113.1 putative OmpR family two-component response regulator VFG1389 Protein 1e-26 44
YM304_38610 YP_007566113.1 putative OmpR family two-component response regulator VFG1390 Protein 1e-31 42