Gene Information

Name : tctD (AZKH_3659)
Accession : YP_007552920.1
Strain : Azoarcus sp. KH32C
Genome accession: NC_020516
Putative virulence/resistance : Virulence
Product : two-component system, OmpR family, response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 4062691 - 4063362 bp
Length : 672 bp
Strand : +
Note : -

DNA sequence : 
ATGCGGATACTGATTGTCGAAGACGACGCGCTCGTCGCGGACGGCCTCAAGCAGGGCCTGCAGCAGCTCGGCTATACCGT
GGACGTCGCGACGAGCGCGGAGGAAGCCGACGCCTTCGTCGCCGGCGAGAGCTTCGACCTTGCGCTGGTCGACATCGGTC
TGCCCGGCGTCGACGGGCTCGAATTCATCCGTCGCTTGCGAGAGCGCGGCAACCGACTGCCGGCGCTCGTGCTGACGGCA
CGCGAAAGCATGGAAGACACGGTCCGCGGGCTCGACGCCGGCGCCGACGACTACATCACAAAACCCTATCGCCTGCCCGA
AGTCGCCGCCCGGATGCGCGCCCTGCTGCGCCGCGCCCATGCCGTCAGCGACGCCTGCCTGCGCCACAACGGGCTCGCGC
TCGACACGCGGACGCGCGCCGCAACGCTCGACGGCGAGCCGATCGAGCTGACGAACCGCGAATGGGCGATCCTCGAGATG
CTGCTGATGGCTTCCCCGGCCGTCGTCAGCAAGGACAAGCTGGTGCAGAGCCTCGCCGGCTGGGACAAGGACATCACGCC
GAACGCGATCGAGGTGCACGTCTCGCGCCTGCGCGGCAAGCTCGCGCCCGGCGCGATCGTGATCCGCACGGTCCGCGGCA
TCGGATATCGCGTCGATGCGCCGGCTGACTGA

Protein sequence : 
MRILIVEDDALVADGLKQGLQQLGYTVDVATSAEEADAFVAGESFDLALVDIGLPGVDGLEFIRRLRERGNRLPALVLTA
RESMEDTVRGLDAGADDYITKPYRLPEVAARMRALLRRAHAVSDACLRHNGLALDTRTRAATLDGEPIELTNREWAILEM
LLMASPAVVSKDKLVQSLAGWDKDITPNAIEVHVSRLRGKLAPGAIVIRTVRGIGYRVDAPAD

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
armR AAN62112.1 putative response-regulator ArmR Not tested PAGI-2(C) Protein 6e-26 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
tctD YP_007552920.1 two-component system, OmpR family, response regulator CP000647.1.gene1136. Protein 2e-29 46
tctD YP_007552920.1 two-component system, OmpR family, response regulator BAC0530 Protein 2e-29 46
tctD YP_007552920.1 two-component system, OmpR family, response regulator CP001918.1.gene2526. Protein 2e-28 45
tctD YP_007552920.1 two-component system, OmpR family, response regulator CP000034.1.gene2022. Protein 2e-27 44
tctD YP_007552920.1 two-component system, OmpR family, response regulator NC_002695.1.913289.p Protein 3e-26 44
tctD YP_007552920.1 two-component system, OmpR family, response regulator CP001138.1.gene1939. Protein 2e-27 44
tctD YP_007552920.1 two-component system, OmpR family, response regulator NC_002516.2.879194.p Protein 6e-29 44
tctD YP_007552920.1 two-component system, OmpR family, response regulator CP004022.1.gene1005. Protein 2e-29 43
tctD YP_007552920.1 two-component system, OmpR family, response regulator BAC0487 Protein 1e-31 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
tctD YP_007552920.1 two-component system, OmpR family, response regulator VFG0475 Protein 2e-27 44
tctD YP_007552920.1 two-component system, OmpR family, response regulator VFG1390 Protein 1e-27 41