
|
Name : WQG_1040 (WQG_1040) Accession : YP_007547181.1 Strain : Bibersteinia trehalosi USDA-ARS-USMARC-192 Genome accession: NC_020515 Putative virulence/resistance : Resistance Product : Dihydropteroate synthase type-2 Function : - COG functional category : - COG ID : - EC number : - Position : 98550 - 99578 bp Length : 1029 bp Strand : + Note : dihydropteroate synthase PRK13753; Dihydropteroate synthase type-2 of root UniRef RepID=DHP2_ECOLX DNA sequence : ATGGGGAATGTAAGTTCCCATACCTATACATACGCAGGAAAACGATCATTTGCTTGCAATTGCGAAGAAAATAATGGAAA ATGTGGACTGGCGCCACCTAACAACCGGTTCGAGCGGACTCACGGGACAAGCCCGTTCGCAGCTCAACCGAAAGTTAGGT TGACGCCTTCGGCGCGGAGGAAAATGGAATATACAAGTAAATCACAAATAGCTCGAAATAAATCGCTCATCATTTTCGGC ATCGTCAACATAACCTCGGACAGTTTCTCCGATGGAGGCCGGTATCTGGCGCCAGACGCAGCCATTGCGCAGGCGCGTAA GCTGATGGCCGAGGGGGCAGATGTGATCGACCTCGGTCCGGCATCCAGCAATCCCGACGCCGCGCCTGTTTCGTCCGACA CAGAAATCGCGCGTATCGCGCCGGTGCTGGACGCGCTCAAGGCAGATGGCATTCCCGTCTCGCTCGACAGTTATCAACCC GCGACGCAAGCCTATGCCTTGTCGCGTGGTGTGGCCTATCTCAATGATATCCGCGGTTTTCCAGACGCTGCGTTCTATCC GCAATTGGCGAAATCATCTGCCAAACTCGTCGTTATGCATTCGGTGCAAGACGGGCAGGCAGATCGGCGCGAGGCACCCG CTGGCGACATCATGGATCACATTGCGGCGTTCTTTGACGCGCGCATCGCGGCGCTGACGGGTGCCGGTATCAAACGCAAC CGCCTTGTCCTTGATCCCGGCATGGGGTTTTTTCTGGGGGCTGCTCCCGAAACCTCGCTCTCGGTGCTGGCGCGGTTCGA TGAATTGCGGCTGCGCTTCGATTTGCCGGTGCTTCTGTCTGTTTCGCGCAAATCCTTTCTGCGCGCGCTCACAGGCCGTG GTCCGGGGGATGTCGGGGCCGCGACACTCGCTGCAGAGCTTGCCGCCGCCGCAGGTGGAGCTGACTTCATCCGCACACAC GAGCCGCGCCCCTTGCGCGACGGGCTGGCGGTATTGGCGGCGCTGAAAGAAACCGCAAGAATTCGTTAA Protein sequence : MGNVSSHTYTYAGKRSFACNCEENNGKCGLAPPNNRFERTHGTSPFAAQPKVRLTPSARRKMEYTSKSQIARNKSLIIFG IVNITSDSFSDGGRYLAPDAAIAQARKLMAEGADVIDLGPASSNPDAAPVSSDTEIARIAPVLDALKADGIPVSLDSYQP ATQAYALSRGVAYLNDIRGFPDAAFYPQLAKSSAKLVVMHSVQDGQADRREAPAGDIMDHIAAFFDARIAALTGAGIKRN RLVLDPGMGFFLGAAPETSLSVLARFDELRLRFDLPVLLSVSRKSFLRALTGRGPGDVGAATLAAELAAAAGGADFIRTH EPRPLRDGLAVLAALKETARIR |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| sul2 | AEZ06044.1 | Sul2, sulphonamide-insensitive dihydropteroate synthase | Not tested | Tn6167 | Protein | 5e-112 | 100 |
| sul2 | AEA34678.1 | dihydropteroate synthase | Not tested | Not named | Protein | 4e-112 | 100 |
| sulI2 | AFV47959.1 | sulphonamide-insensitive dihydropteroate synthase SulI2 | Not tested | AbaR25 | Protein | 4e-112 | 100 |
| BJAB0868_00253 | YP_008211579.1 | Dihydropteroate synthase-related enzyme | Not tested | AbaR26 | Protein | 9e-111 | 99 |
| ABK1_0255 | YP_005512827.1 | Dihydropteroate synthase type-2 | Not tested | AbaR4d | Protein | 3e-111 | 99 |
| BJAB07104_00246 | YP_008207711.1 | Dihydropteroate synthase-related enzyme | Not tested | AbaR25 | Protein | 3e-111 | 99 |
| sul1 | AGF35064.1 | Sul1 dihydropteroate synthase | Not tested | SGI1 | Protein | 6e-54 | 53 |
| sul1 | ACY75524.1 | Sul1 | Not tested | Tn6060 | Protein | 6e-54 | 53 |
| sul1 | ADZ05750.1 | dihydropteroate synthase | Not tested | AbaR10 | Protein | 5e-54 | 53 |
| sul1 | AGK06934.1 | Sul1 dihydropteroate synthase | Not tested | SGI1 | Protein | 6e-54 | 53 |
| sul1 | ACY75531.1 | Sul1 | Not tested | Tn6060 | Protein | 6e-54 | 53 |
| ACICU_00228 | YP_001844887.1 | dihydropteroate synthase | Not tested | AbaR20 | Protein | 8e-54 | 53 |
| sul1 | AGK06980.1 | Sul1 dihydropteroate synthase | Not tested | SGI1 | Protein | 6e-54 | 53 |
| sul1 | ADI24148.1 | dihydropteroate synthase | Not tested | AbaR1 | Protein | 6e-54 | 53 |
| sul1 | YP_005797135.1 | sulfonamide-resistant dihydropteroate synthase | Not tested | AbaR4e | Protein | 8e-54 | 53 |
| sul1 | AGK07017.1 | Sul1 dihydropteroate synthase | Not tested | SGI1 | Protein | 6e-54 | 53 |
| sul1 | ADZ05756.1 | dihydropteroate synthase | Not tested | AbaR10 | Protein | 6e-54 | 53 |
| sul1 | YP_005797151.1 | sulfonamide-resistant dihydropteroate synthase | Not tested | AbaR4e | Protein | 8e-54 | 53 |
| sul1 | AGK07075.1 | Sul1 dihydropteroate synthase | Not tested | SGI1 | Protein | 6e-54 | 53 |
| sul1 | AET25390.1 | Sul1 | Not tested | PAGI-2(C) | Protein | 6e-54 | 53 |
| sul1 | ADZ05806.1 | dihydropteroate synthase | Not tested | AbaR20 | Protein | 1e-53 | 53 |
| sulI | YP_006098378.1 | dihydropteroate synthase type-1 | Not tested | Tn2411 | Protein | 8e-54 | 53 |
| sul1 | AGK07110.1 | Sul1 dihydropteroate synthase | Not tested | SGI1 | Protein | 6e-54 | 53 |
| sul1 | AFG30113.1 | Sul1 | Not tested | PAGI-2 | Protein | 6e-54 | 53 |
| sul1 | ACN81027.1 | Sul1, sulfonamide-resistant dihydropteroate synthase | Not tested | AbaR5 | Protein | 8e-54 | 53 |
| sul1 | AFV53112.1 | dihydropteroate synthase | Not tested | AbGRI2-1 | Protein | 6e-54 | 53 |
| sul1 | AGF34990.1 | Sul1 dihydropteroate synthase | Not tested | SGI1 | Protein | 6e-54 | 53 |
| sul1 | AAG03004.2 | sulfonamide resistance protein | Not tested | SGI1 | Protein | 6e-54 | 53 |
| sul1 | AGK36648.1 | Sul1 | Not tested | AbaR26 | Protein | 6e-54 | 53 |
| sul1 | AGF35029.1 | Sul1 dihydropteroate synthase | Not tested | SGI1 | Protein | 6e-54 | 53 |
| sul1 | ABB48429.1 | sulfonamide insensitive dihydropteroate synthase | Not tested | SGI1 | Protein | 6e-54 | 53 |
| sul1 | ACN81038.2 | Sul1, sulfonamide-resistant dihydropteroate synthase | Not tested | AbaR5 | Protein | 7e-54 | 53 |
| sul1 | ACS32048.1 | Sul1; sulfonamide-insensitive dihydropteroate synthase | Not tested | SGI2 | Protein | 6e-54 | 53 |
| sul1 | YP_005160002.1 | dihydropteroate synthase | Not tested | Not named | Protein | 8e-54 | 53 |
| sul1 | ACF06160.1 | dihydropteroate synthase | Not tested | Tn5036-like | Protein | 4e-54 | 53 |
| sul1 | ACF06164.1 | dihydropteroate synthase | Not tested | Tn5036-like | Protein | 1e-53 | 53 |
| sulI | CAJ77050.1 | sul1delta fusion protein | Not tested | AbaR1 | Protein | 4e-54 | 53 |
| sulI | CAJ77089.1 | sul1delta fusion protein | Not tested | AbaR1 | Protein | 4e-54 | 53 |
| sulI | CAJ77053.1 | sul1delta fusion protein | Not tested | AbaR1 | Protein | 3e-54 | 53 |
| Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
| WQG_1040 | YP_007547181.1 | Dihydropteroate synthase type-2 | DQ464881.1.gene2.p01 | Protein | 1e-110 | 99 |
| WQG_1040 | YP_007547181.1 | Dihydropteroate synthase type-2 | AJ459418.gene.p01 | Protein | 6e-57 | 53 |
| WQG_1040 | YP_007547181.1 | Dihydropteroate synthase type-2 | DQ143913.1.gene6.p01 | Protein | 6e-54 | 53 |
| WQG_1040 | YP_007547181.1 | Dihydropteroate synthase type-2 | HQ451074.1.gene20.p0 | Protein | 4e-54 | 53 |
| WQG_1040 | YP_007547181.1 | Dihydropteroate synthase type-2 | AF174129.3.gene6.p01 | Protein | 4e-54 | 53 |
| WQG_1040 | YP_007547181.1 | Dihydropteroate synthase type-2 | U37105.2.gene6.p01 | Protein | 4e-54 | 53 |
| WQG_1040 | YP_007547181.1 | Dihydropteroate synthase type-2 | AY162283.2.gene6.p01 | Protein | 4e-54 | 53 |
| WQG_1040 | YP_007547181.1 | Dihydropteroate synthase type-2 | EF118171.1.gene7.p01 | Protein | 4e-54 | 53 |
| WQG_1040 | YP_007547181.1 | Dihydropteroate synthase type-2 | AB061794.1.gene5.p01 | Protein | 4e-54 | 53 |
| WQG_1040 | YP_007547181.1 | Dihydropteroate synthase type-2 | AF313471.1.gene7.p01 | Protein | 4e-54 | 53 |
| WQG_1040 | YP_007547181.1 | Dihydropteroate synthase type-2 | AY339625.2.gene19.p0 | Protein | 4e-54 | 53 |
| WQG_1040 | YP_007547181.1 | Dihydropteroate synthase type-2 | AY740681.1.gene7.p01 | Protein | 4e-54 | 53 |
| WQG_1040 | YP_007547181.1 | Dihydropteroate synthase type-2 | AF191564.1.gene5.p01 | Protein | 3e-54 | 53 |
| WQG_1040 | YP_007547181.1 | Dihydropteroate synthase type-2 | NC_011586.7045179.p0 | Protein | 2e-54 | 53 |
| WQG_1040 | YP_007547181.1 | Dihydropteroate synthase type-2 | NC_011586.7045208.p0 | Protein | 3e-53 | 52 |
| WQG_1040 | YP_007547181.1 | Dihydropteroate synthase type-2 | CP002695.1.gene1085. | Protein | 2e-32 | 41 |