Gene Information

Name : C427_4912 (C427_4912)
Accession : YP_007546359.1
Strain : Glaciecola psychrophila 170
Genome accession: NC_020514
Putative virulence/resistance : Unknown
Product : IS3, transposase
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 4740244 - 4740927 bp
Length : 684 bp
Strand : +
Note : -

DNA sequence :
GTGTATGGCTGTCCACGCATCACACATGAGCTGCGCCGTTCGGGTGAAACATGCGATGAAAACCGCGTTGCTAAGTTGAT
GAAGCAAGCCAAGCTCAGAGCTAATATTGGCTATAAACGGCGCTACTTTGAGCCTTCTACGCCTCATATTGCAGCAGATA
ACCATCTACAGCAGCAATTTGTTGTGTGCGAGCCTGATACCGCTTGGGTTGGAGATATTACTTACATCAAGACTTATGAG
GGATGGTTGTATCTGGCTGTCGTATTGGACTTGTTCTCACGCAAAGTGATTGGTTGGTCAATGCAGCCGACTATGACATC
GGATATTGTGATTAAAGCGCTGCTCATGGCAGTATGGCAACGGCCCAAAGCAACACAGGTGATTGTTCACAGCGATCAAG
GAAGCCAATATGCTAGCGGTGATTATCGAGACTTCCTGAAAGCGCATAATCTGACTCCGAGTATGAGCAGACGAGGACAT
TGTCTGGATAATGCTGTTGCAGAAAGTTTTTTCCACTCGCTCAAGACTGAACGTGTAAAGCGAAAAGTGTACGCAACCCG
AAGTGAAGCCAAAGCAGATTTGTTTGATTACATAGAAGTGTTTTACAATCGAACGCGACTGCATAGCCATCTTGGCCATG
TGTCTCCAGATGAATATGAAATCATGTATTCACAGGCAAGCTAA

Protein sequence :
MYGCPRITHELRRSGETCDENRVAKLMKQAKLRANIGYKRRYFEPSTPHIAADNHLQQQFVVCEPDTAWVGDITYIKTYE
GWLYLAVVLDLFSRKVIGWSMQPTMTSDIVIKALLMAVWQRPKATQVIVHSDQGSQYASGDYRDFLKAHNLTPSMSRRGH
CLDNAVAESFFHSLKTERVKRKVYATRSEAKADLFDYIEVFYNRTRLHSHLGHVSPDEYEIMYSQAS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
ECO111_3732 YP_003236068.1 putative IS3 transposase InsF Not tested LEE Protein 1e-41 48
unnamed AAL57519.1 transposase 1 Not tested LEE Protein 3e-42 48
unnamed AAL57581.1 transposase 1 Not tested LEE Protein 3e-42 48
tnpB CAB61574.1 transposase B Not tested HPI Protein 3e-42 47
trp1329B CAB46576.1 IS1329 transposase B Not tested HPI Protein 2e-42 47
insF CAC43414.1 transposase of insertion element IS3 Not tested PAI III 536 Protein 4e-41 46
orfB ACX47958.1 IS1359 transposase; OrfB Not tested SGI1 Protein 3e-36 46
orfB YP_001217329.1 transposase OrfAB subunit B Not tested VPI-2 Protein 4e-36 46
VPI2_0008c ACA01825.1 transposase OrfAB subunit B Not tested VPI-2 Protein 3e-36 46
orfB AGK06910.1 IS1359 transposase; OrfB Not tested SGI1 Protein 3e-36 46
overlap with orfA characteristic of IS3 family members AGK06947.1 IS1359 transposase; OrfB Not tested SGI1 Protein 3e-36 46
orfB AGK06993.1 IS1359 transposase; OrfB Not tested SGI1 Protein 3e-36 46
orfB AGK07051.1 IS1359 transposase; OrfB Not tested SGI1 Protein 3e-36 46
VC1789 NP_231424.1 transposase OrfAB subunit B Not tested VPI-2 Protein 4e-36 46
tnpA AAD44733.1 TnpA Not tested SHI-2 Protein 7e-39 45
l7094 CAD33743.1 ORF B protein Not tested PAI I 536 Protein 3e-35 44
orfB CAE85178.1 OrfB protein, IS911 Not tested PAI V 536 Protein 3e-35 44
unnamed CAI43898.1 putative transposase Not tested LEE Protein 2e-34 43
aec65 AAW51748.1 Aec65 Not tested AGI-3 Protein 2e-34 43
ECO111_3779 YP_003236114.1 putative IS602 transposase OrfB Not tested LEE Protein 2e-34 43
orfB AGK07090.1 IS1133 transposase; OrfB Not tested SGI1 Protein 1e-37 43
tnpA1133 ACK44540.1 TnpA Not tested SGI1 Protein 1e-37 43
orfB AGK07032.1 IS1133 transposase; OrfB Not tested SGI1 Protein 1e-37 43
unnamed AAC31485.1 L0006 Not tested LEE Protein 4e-33 42
ECs4537 NP_312564.1 hypothetical protein Not tested LEE Protein 6e-33 42
unnamed ACU09432.1 IS911 transposase orfB Not tested LEE Protein 4e-33 42
Z5089 NP_290241.1 transposase Not tested LEE Protein 6e-33 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
C427_4912 YP_007546359.1 IS3, transposase VFG1631 Protein 2e-41 46
C427_4912 YP_007546359.1 IS3, transposase VFG1122 Protein 1e-36 46
C427_4912 YP_007546359.1 IS3, transposase VFG1484 Protein 2e-35 44
C427_4912 YP_007546359.1 IS3, transposase VFG0785 Protein 2e-33 42