Gene Information

Name : walR (BSU6051_40410)
Accession : YP_007536043.1
Strain : Bacillus subtilis 6051-HGW
Genome accession: NC_020507
Putative virulence/resistance : Virulence
Product : two-component response regulator YycG
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 4153700 - 4154407 bp
Length : 708 bp
Strand : -
Note : Evidence 1a: Function experimentally demonstrated in the studied strain; PubMedId: 10878122, 12682299, 15015732, 15153768, 17307850, 17370266, 18789936, 19019149; Product type r: regulator

DNA sequence :
ATGGATAAAAAGATCCTTGTAGTAGATGATGAAAAACCGATTGCAGATATATTGGAATTTAACTTAAGAAAAGAAGGCTA
TGAAGTGCACTGTGCCCACGACGGAAACGAAGCCGTTGAAATGGTAGAAGAGCTTCAGCCTGATTTAATTCTTTTAGATA
TTATGCTCCCAAATAAAGACGGCGTTGAAGTATGCCGCGAAGTCAGAAAGAAATACGATATGCCAATCATTATGCTGACG
GCTAAGGATTCAGAAATTGACAAGGTTATCGGGCTTGAAATCGGTGCTGATGACTATGTCACAAAACCATTCAGCACACG
CGAGCTCTTGGCGCGTGTAAAAGCGAACCTGCGCCGCCAGCTGACAACAGCGCCTGCGGAGGAAGAGCCTTCCTCTAACG
AGATTCATATCGGCTCTCTCGTCATCTTCCCTGACGCGTACGTTGTATCAAAACGAGACGAAACAATCGAATTGACTCAT
CGTGAGTTCGAATTGCTTCATTATTTAGCAAAACATATCGGACAAGTGATGACCCGTGAACATTTGCTTCAAACCGTTTG
GGGCTATGATTACTTCGGCGATGTCAGAACGGTTGACGTAACAGTCCGCCGGCTTCGTGAAAAAATCGAGGACAACCCGA
GCCATCCAAATTGGATCGTCACACGCCGTGGTGTAGGTTATTACTTGAGAAACCCAGAACAGGACTAA

Protein sequence :
MDKKILVVDDEKPIADILEFNLRKEGYEVHCAHDGNEAVEMVEELQPDLILLDIMLPNKDGVEVCREVRKKYDMPIIMLT
AKDSEIDKVIGLEIGADDYVTKPFSTRELLARVKANLRRQLTTAPAEEEPSSNEIHIGSLVIFPDAYVVSKRDETIELTH
REFELLHYLAKHIGQVMTREHLLQTVWGYDYFGDVRTVDVTVRRLREKIEDNPSHPNWIVTRRGVGYYLRNPEQD

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 8e-32 42
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 1e-31 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
walR YP_007536043.1 two-component response regulator YycG NC_012469.1.7685629. Protein 2e-64 68
walR YP_007536043.1 two-component response regulator YycG NC_009782.5559369.p0 Protein 4e-52 55
walR YP_007536043.1 two-component response regulator YycG NC_002951.3237708.p0 Protein 4e-52 55
walR YP_007536043.1 two-component response regulator YycG NC_003923.1003749.p0 Protein 4e-52 55
walR YP_007536043.1 two-component response regulator YycG NC_002758.1121668.p0 Protein 4e-52 55
walR YP_007536043.1 two-component response regulator YycG NC_009641.5332272.p0 Protein 4e-52 55
walR YP_007536043.1 two-component response regulator YycG NC_013450.8614421.p0 Protein 4e-52 55
walR YP_007536043.1 two-component response regulator YycG NC_007793.3914279.p0 Protein 4e-52 55
walR YP_007536043.1 two-component response regulator YycG NC_002952.2859905.p0 Protein 4e-52 55
walR YP_007536043.1 two-component response regulator YycG NC_007622.3794472.p0 Protein 3e-52 55
walR YP_007536043.1 two-component response regulator YycG NC_002745.1124361.p0 Protein 4e-52 55
walR YP_007536043.1 two-component response regulator YycG HE999704.1.gene2815. Protein 2e-48 54
walR YP_007536043.1 two-component response regulator YycG AE016830.1.gene1681. Protein 3e-46 49
walR YP_007536043.1 two-component response regulator YycG NC_012469.1.7686381. Protein 1e-43 48
walR YP_007536043.1 two-component response regulator YycG FJ349556.1.orf0.gene Protein 1e-40 47
walR YP_007536043.1 two-component response regulator YycG AM180355.1.gene1830. Protein 3e-38 46
walR YP_007536043.1 two-component response regulator YycG AE000516.2.gene3505. Protein 3e-37 45
walR YP_007536043.1 two-component response regulator YycG AF155139.2.orf0.gene Protein 2e-36 45
walR YP_007536043.1 two-component response regulator YycG HE999704.1.gene1528. Protein 3e-32 44
walR YP_007536043.1 two-component response regulator YycG NC_005054.2598277.p0 Protein 1e-36 43
walR YP_007536043.1 two-component response regulator YycG NC_014475.1.orf0.gen Protein 1e-36 43
walR YP_007536043.1 two-component response regulator YycG DQ212986.1.gene4.p01 Protein 3e-36 43
walR YP_007536043.1 two-component response regulator YycG NC_003923.1003417.p0 Protein 5e-34 43
walR YP_007536043.1 two-component response regulator YycG NC_013450.8614146.p0 Protein 5e-34 43
walR YP_007536043.1 two-component response regulator YycG NC_002951.3238224.p0 Protein 5e-34 43
walR YP_007536043.1 two-component response regulator YycG NC_007793.3914065.p0 Protein 5e-34 43
walR YP_007536043.1 two-component response regulator YycG NC_002758.1121390.p0 Protein 5e-34 43
walR YP_007536043.1 two-component response regulator YycG NC_010079.5776364.p0 Protein 5e-34 43
walR YP_007536043.1 two-component response regulator YycG NC_002952.2859858.p0 Protein 5e-34 43
walR YP_007536043.1 two-component response regulator YycG NC_007622.3794948.p0 Protein 5e-34 43
walR YP_007536043.1 two-component response regulator YycG AE015929.1.gene1106. Protein 9e-31 43
walR YP_007536043.1 two-component response regulator YycG CP000034.1.gene2186. Protein 2e-29 43
walR YP_007536043.1 two-component response regulator YycG NC_002695.1.916589.p Protein 2e-29 43
walR YP_007536043.1 two-component response regulator YycG BAC0039 Protein 2e-29 43
walR YP_007536043.1 two-component response regulator YycG AF130997.1.orf0.gene Protein 8e-36 42
walR YP_007536043.1 two-component response regulator YycG CP001918.1.gene5135. Protein 2e-27 42
walR YP_007536043.1 two-component response regulator YycG CP001138.1.gene2239. Protein 4e-28 42
walR YP_007536043.1 two-component response regulator YycG BAC0596 Protein 4e-28 42
walR YP_007536043.1 two-component response regulator YycG CP001918.1.gene3444. Protein 1e-28 42
walR YP_007536043.1 two-component response regulator YycG AF162694.1.orf4.gene Protein 1e-32 41
walR YP_007536043.1 two-component response regulator YycG CP000034.1.gene3834. Protein 2e-31 41
walR YP_007536043.1 two-component response regulator YycG NC_002695.1.915041.p Protein 2e-31 41
walR YP_007536043.1 two-component response regulator YycG CP004022.1.gene3215. Protein 6e-35 41
walR YP_007536043.1 two-component response regulator YycG CP004022.1.gene1676. Protein 1e-28 41
walR YP_007536043.1 two-component response regulator YycG CP000647.1.gene2531. Protein 1e-28 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
walR YP_007536043.1 two-component response regulator YycG VFG1389 Protein 9e-29 45
walR YP_007536043.1 two-component response regulator YycG VFG1390 Protein 1e-35 42
walR YP_007536043.1 two-component response regulator YycG VFG1563 Protein 5e-32 42
walR YP_007536043.1 two-component response regulator YycG VFG1702 Protein 4e-32 41