Gene Information

Name : yclJ (BSU6051_03750)
Accession : YP_007532302.1
Strain : Bacillus subtilis 6051-HGW
Genome accession: NC_020507
Putative virulence/resistance : Virulence
Product : two-component response regulator YclK
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 426575 - 427258 bp
Length : 684 bp
Strand : +
Note : Evidence 1a: Function experimentally demonstrated in the studied strain; PubMedId: 11717295, 15375128; Product type r: regulator

DNA sequence :
ATGAAAATATTAATGATAGAAGATAATGTTAGTGTATGTACGATGACGGAGATGTTCTTTTTTAAAGAAGGTTTTGAAGC
CGAATTCGTTCATGACGGGTTAGAAGGGTACCAGCGTTTTACGGAAGAAAATTGGGATCTAATCATTTTGGATATCATGC
TTCCATCTATGGACGGCGTGACCATCTGCAGAAAAATAAGAGAGACAAGCACGGTGCCGATTATCATGCTGACTGCCAAA
GACACTGAATCAGATCAGGTCATCGGTTTTGAGATGGGGGCGGACGATTATGTCACAAAGCCGTTCAGCCCGCTGACATT
GGTTGCCCGCATCAAAGCCGTCATCAGAAGATATAAGGCGACAGGCAAAGCGGTTATTGATGAAGATATGATTGAAACGG
AATGCTTTACCATTAATAAGAAGACGAGAGAAGTATTATTAAACGGAGAGCCTGTAGAAAATCTCACGCCGAAGGAATTC
GATCTGCTTTATTACCTTGTCCAAAATCCGCGGCAGGTGTTCTCCAGAGAACAGCTGCTTGAGCAGGTATGGGGCTATCA
ATTTTATGGAGATGAGCGAACGGTTGACGTTCATATCAAACGGCTGCGGAAAAAGCTTGCCAGCGAGGACAAGCCTTTCC
TGTATACTGTGTGGGGAGTAGGGTATAAATTTGATGAAGATTAA

Protein sequence :
MKILMIEDNVSVCTMTEMFFFKEGFEAEFVHDGLEGYQRFTEENWDLIILDIMLPSMDGVTICRKIRETSTVPIIMLTAK
DTESDQVIGFEMGADDYVTKPFSPLTLVARIKAVIRRYKATGKAVIDEDMIETECFTINKKTREVLLNGEPVENLTPKEF
DLLYYLVQNPRQVFSREQLLEQVWGYQFYGDERTVDVHIKRLRKKLASEDKPFLYTVWGVGYKFDED

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 4e-39 42
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 2e-38 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
yclJ YP_007532302.1 two-component response regulator YclK HE999704.1.gene2815. Protein 1e-43 45
yclJ YP_007532302.1 two-component response regulator YclK NC_002952.2859905.p0 Protein 9e-41 44
yclJ YP_007532302.1 two-component response regulator YclK NC_003923.1003749.p0 Protein 1e-40 44
yclJ YP_007532302.1 two-component response regulator YclK NC_002758.1121668.p0 Protein 1e-40 44
yclJ YP_007532302.1 two-component response regulator YclK NC_009641.5332272.p0 Protein 1e-40 44
yclJ YP_007532302.1 two-component response regulator YclK NC_013450.8614421.p0 Protein 1e-40 44
yclJ YP_007532302.1 two-component response regulator YclK NC_007793.3914279.p0 Protein 1e-40 44
yclJ YP_007532302.1 two-component response regulator YclK NC_002745.1124361.p0 Protein 1e-40 44
yclJ YP_007532302.1 two-component response regulator YclK NC_007622.3794472.p0 Protein 8e-41 44
yclJ YP_007532302.1 two-component response regulator YclK NC_009782.5559369.p0 Protein 1e-40 44
yclJ YP_007532302.1 two-component response regulator YclK NC_002951.3237708.p0 Protein 1e-40 44
yclJ YP_007532302.1 two-component response regulator YclK NC_012469.1.7685629. Protein 4e-41 43
yclJ YP_007532302.1 two-component response regulator YclK AE016830.1.gene1681. Protein 2e-41 43
yclJ YP_007532302.1 two-component response regulator YclK AF155139.2.orf0.gene Protein 9e-41 42
yclJ YP_007532302.1 two-component response regulator YclK FJ349556.1.orf0.gene Protein 6e-41 42
yclJ YP_007532302.1 two-component response regulator YclK DQ212986.1.gene4.p01 Protein 3e-37 42
yclJ YP_007532302.1 two-component response regulator YclK NC_014475.1.orf0.gen Protein 5e-38 42
yclJ YP_007532302.1 two-component response regulator YclK AM180355.1.gene1830. Protein 2e-35 42
yclJ YP_007532302.1 two-component response regulator YclK NC_005054.2598277.p0 Protein 5e-38 42
yclJ YP_007532302.1 two-component response regulator YclK AE000516.2.gene3505. Protein 1e-38 42
yclJ YP_007532302.1 two-component response regulator YclK AE015929.1.gene1106. Protein 6e-30 41
yclJ YP_007532302.1 two-component response regulator YclK NC_002952.2859858.p0 Protein 7e-35 41
yclJ YP_007532302.1 two-component response regulator YclK NC_007622.3794948.p0 Protein 7e-35 41
yclJ YP_007532302.1 two-component response regulator YclK NC_003923.1003417.p0 Protein 7e-35 41
yclJ YP_007532302.1 two-component response regulator YclK NC_013450.8614146.p0 Protein 7e-35 41
yclJ YP_007532302.1 two-component response regulator YclK NC_002951.3238224.p0 Protein 7e-35 41
yclJ YP_007532302.1 two-component response regulator YclK NC_007793.3914065.p0 Protein 7e-35 41
yclJ YP_007532302.1 two-component response regulator YclK NC_002758.1121390.p0 Protein 7e-35 41
yclJ YP_007532302.1 two-component response regulator YclK NC_010079.5776364.p0 Protein 7e-35 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
yclJ YP_007532302.1 two-component response regulator YclK VFG1563 Protein 2e-39 42
yclJ YP_007532302.1 two-component response regulator YclK VFG1702 Protein 8e-39 42
yclJ YP_007532302.1 two-component response regulator YclK VFG1389 Protein 3e-31 42