Gene Information

Name : yceD (BSU6051_02900)
Accession : YP_007532216.1
Strain : Bacillus subtilis 6051-HGW
Genome accession: NC_020507
Putative virulence/resistance : Resistance
Product : putative stress adaptation protein YceD
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 312779 - 313360 bp
Length : 582 bp
Strand : +
Note : Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; Product type pf: putative factor

DNA sequence :
ATGACAATTTCATTGGCAAAAGGACAAAAAGTAGATTTAACAAAAACAAATCCGGGTCTTTCAAAGGTTGTTGTCGGTTT
AGGCTGGGATACGAACAAGTATGACGGCGGGCACGACTTTGATCTTGACTCAAGTGTGTTTCTGTTAGACGCCGCGGGCA
AATGCGCGTCACCAAACGACTTTATTTTCTACAACCAGCTTGAAGGCGGCAACGGTTCAGTCGTTCATTCAGGCGACAAC
CTGACTGGTGCTGGCGAAGGCGACGATGAGAATGTAAAAGTAAATCTCAGCGCTGTACCGGCAAACATTGATAAAATCTC
ATTTGTTATTACCATTCACGATGCAGAAGCGCGCAGCCAAAACTTTGGACAAGTATCAAACGCGTTTGTCCGCATCGTAA
ATGAAGAAACAAATGAAGAGCTCATCCGTTACGATCTTGCAGAAGATTTCTCTATTGAAACGGCAATCATTGCAGGGGAG
CTTTACAGACATAACGGCGAGTGGAAATTCTCAGCAATCGGCTCAGGCTACCAAGGCGGCCTTGCCCGCATTGCAACAGA
CTACGGTTTGCAAGTCGGTTAA

Protein sequence :
MTISLAKGQKVDLTKTNPGLSKVVVGLGWDTNKYDGGHDFDLDSSVFLLDAAGKCASPNDFIFYNQLEGGNGSVVHSGDN
LTGAGEGDDENVKVNLSAVPANIDKISFVITIHDAEARSQNFGQVSNAFVRIVNEETNEELIRYDLAEDFSIETAIIAGE
LYRHNGEWKFSAIGSGYQGGLARIATDYGLQVG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-49 58
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-49 58
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 3e-50 58
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 3e-49 57
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 7e-41 52
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 6e-41 52
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-40 52
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-40 52
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-24 41
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-24 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
yceD YP_007532216.1 putative stress adaptation protein YceD BAC0389 Protein 1e-49 59
yceD YP_007532216.1 putative stress adaptation protein YceD BAC0390 Protein 3e-44 53
yceD YP_007532216.1 putative stress adaptation protein YceD BAC0392 Protein 5e-25 41