Gene Information

Name : ebrB (BSU6051_17290)
Accession : YP_007533683.1
Strain : Bacillus subtilis 6051-HGW
Genome accession: NC_020507
Putative virulence/resistance : Resistance
Product : small multidrug efflux transporter EbrB
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1864689 - 1865042 bp
Length : 354 bp
Strand : -
Note : Evidence 1a: Function experimentally demonstrated in the studied strain; PubMedId: 10735876, 15849754, 16750162, 16850406; Product type t: transporter

DNA sequence :
ATGAGAGGATTGCTTTATTTGGCTCTCGCCATTGTATCTGAAGTGTTTGGGAGCACGATGTTGAAGCTTTCAGAAGGATT
TACACAAGCCTGGCCCATTGCCGGAGTCATAGTCGGATTTCTTTCTGCTTTTACGTTTCTAAGCTTTTCTTTAAAAACAA
TTGACTTATCAAGCGCGTATGCAACATGGTCGGGCGTTGGTACCGCGCTTACAGCAATTGTCGGGTTTTTGCTTTTTGGC
GAAACCATCAGTTTAAAAGGTGTATTCGGTCTCACGCTTGTCATTGCAGGCGTGGTCGTGCTAAATCAATCGAAAGCCCA
CGCTGAAGATAAAAAACAGACGGCCTGTGAGTGA

Protein sequence :
MRGLLYLALAIVSEVFGSTMLKLSEGFTQAWPIAGVIVGFLSAFTFLSFSLKTIDLSSAYATWSGVGTALTAIVGFLLFG
ETISLKGVFGLTLVIAGVVVLNQSKAHAEDKKQTACE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
qacEdelta1 CAJ77088.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 4e-09 41
qacEdelta1 ACN81026.1 QacEdelta1 Not tested AbaR5 Protein 6e-09 41
qacEdelta1 AFV53123.1 QacEdelta1 multidrug exporter Not tested AbGRI2-1 Protein 4e-09 41
qacEdelta1 AGF35063.1 QacEdelta1 Not tested SGI1 Protein 4e-09 41
qacE-deltal ACF06159.1 quartenary ammonium compound resistance protein Not tested Tn5036-like Protein 4e-09 41
qacEdelta1 AAK02047.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 4e-09 41
qacEdelta1 AGK36647.1 QacEdelta1 Not tested AbaR26 Protein 4e-09 41
qacEdelta1 AGK06933.1 QacEdelta1 Not tested SGI1 Protein 4e-09 41
qacEdelta1 AAK02056.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 4e-09 41
qacEdelta1 AGK06970.1 QacEdelta1 Not tested SGI1 Protein 4e-09 41
qacE-delta1 ACY75523.1 QacE-delta1 Not tested Tn6060 Protein 4e-09 41
qacEdelta1 ABB48428.1 QacEdelta1 Not tested SGI1 Protein 4e-09 41
qacEdelta1 AGK06979.1 QacEdelta1 Not tested SGI1 Protein 4e-09 41
qacE-delta1 ACY75532.1 QacE-delta1 Not tested Tn6060 Protein 4e-09 41
qacEdelta1 ABZ01839.1 QacEdelta1 Not tested SGI2 Protein 4e-09 41
ACICU_00227 YP_001844886.1 membrane transporter Not tested AbaR20 Protein 6e-09 41
qacEdelta1 AGK07016.1 QacEdelta1 Not tested SGI1 Protein 4e-09 41
qacE-delta1 AET25389.1 QacE-delta1 Not tested PAGI-2(C) Protein 4e-09 41
qacEdelta1 CAJ77030.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 4e-09 41
qacEdelta1 YP_005797134.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 6e-09 41
qacEdelta1 AGK07074.1 QacEdelta1 Not tested SGI1 Protein 4e-09 41
qacE-delta1 AFG30112.1 QacE-delta1 Not tested PAGI-2 Protein 4e-09 41
qacEdelta1 CAJ77049.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 4e-09 41
qacEdelta1 YP_005797150.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 6e-09 41
qacEdelta1 AGK07100.1 QacEdelta1 Not tested SGI1 Protein 4e-09 41
qacEdelta1 AGF34989.1 QacEdelta1 Not tested SGI1 Protein 4e-09 41
qacEdelta1 CAJ77052.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 4e-09 41
ebr YP_006098377.1 putative ethidium bromide resistance protein Not tested Tn2411 Protein 6e-09 41
qacEdelta1 AGK07109.1 QacEdelta1 Not tested SGI1 Protein 4e-09 41
qacEdelta1 AGF35028.1 QacEdelta1 Not tested SGI1 Protein 4e-09 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ebrB YP_007533683.1 small multidrug efflux transporter EbrB BAC0140 Protein 2e-38 95
ebrB YP_007533683.1 small multidrug efflux transporter EbrB BAC0139 Protein 4e-11 50
ebrB YP_007533683.1 small multidrug efflux transporter EbrB BAC0322 Protein 1e-10 48
ebrB YP_007533683.1 small multidrug efflux transporter EbrB BAC0192 Protein 7e-10 46
ebrB YP_007533683.1 small multidrug efflux transporter EbrB BAC0321 Protein 6e-10 44
ebrB YP_007533683.1 small multidrug efflux transporter EbrB BAC0002 Protein 2e-10 44
ebrB YP_007533683.1 small multidrug efflux transporter EbrB NC_010410.6003348.p0 Protein 2e-10 44
ebrB YP_007533683.1 small multidrug efflux transporter EbrB BAC0477 Protein 2e-06 43
ebrB YP_007533683.1 small multidrug efflux transporter EbrB CP004022.1.gene1549. Protein 8e-13 42
ebrB YP_007533683.1 small multidrug efflux transporter EbrB BAC0377 Protein 3e-13 42
ebrB YP_007533683.1 small multidrug efflux transporter EbrB NC_002695.1.913273.p Protein 6e-12 41
ebrB YP_007533683.1 small multidrug efflux transporter EbrB BAC0323 Protein 2e-09 41
ebrB YP_007533683.1 small multidrug efflux transporter EbrB BAC0216 Protein 2e-06 41