Gene Information

Name : H924_04175 (H924_04175)
Accession : YP_007530184.1
Strain : Corynebacterium callunae DSM 20147
Genome accession: NC_020506
Putative virulence/resistance : Virulence
Product : hypothetical protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 892446 - 893141 bp
Length : 696 bp
Strand : +
Note : COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain

DNA sequence :
ATGAAGATTTTGGTTGTTGATGATGAGCAAGCTGTACGCGAATCATTGCGTAGGTCGCTTACATTCAACGGATACAACGT
GATTCTCGCTGAGGACGGCATTCAAGCCCTTGAAGTAATTGATAGGGAACAGCCTGGTTTGGTGATTCTGGATGTAATGA
TGCCGCATTTGGATGGTTTGGAAGTATGTCGGCAACTGAGAAGCGAAGGCGATGATCGCCCCATCTTGGTGCTGACAGCT
CGAGACAATGTCTCCGACCGCGTAGGTGGCCTAGATGCCGGCGCGGATGATTACCTGGCTAAGCCTTTCGCTCTGGAAGA
ATTGCTTGCACGTGTGCGTTCTCTTGTACGTCGTTCTGCAGCAGAATCTAACCAGTCATTGGTTGATCGCACTGAACTAT
CCTTTGGCGATCTTAGGCTTAATCCAGAAACTCGCGATGTCACCCGTAACGGGAGAATTATCAGCCTTACCCGCACTGAG
TTCTCCCTGCTGGAATTATTGATGCAAAATCCTCGCCGGGTGCTTTCACGTTCGGCCATCTTGGAAGAGGTGTGGGGTTA
TGATTTCCCGACCTCCGGAAATGCGCTGGAAGTTTATATCGGCTACCTACGCCGTAAGACTGAACAAGAGGGCGAAAGCC
GTTTGATCTACACCGTGCGTGGGGTGGGATACGTCTTGCGGGAGACCGCTCCGTGA

Protein sequence :
MKILVVDDEQAVRESLRRSLTFNGYNVILAEDGIQALEVIDREQPGLVILDVMMPHLDGLEVCRQLRSEGDDRPILVLTA
RDNVSDRVGGLDAGADDYLAKPFALEELLARVRSLVRRSAAESNQSLVDRTELSFGDLRLNPETRDVTRNGRIISLTRTE
FSLLELLMQNPRRVLSRSAILEEVWGYDFPTSGNALEVYIGYLRRKTEQEGESRLIYTVRGVGYVLRETAP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-33 45
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 8e-33 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
H924_04175 YP_007530184.1 hypothetical protein HE999704.1.gene1528. Protein 2e-37 45
H924_04175 YP_007530184.1 hypothetical protein BAC0638 Protein 5e-25 45
H924_04175 YP_007530184.1 hypothetical protein BAC0083 Protein 9e-33 44
H924_04175 YP_007530184.1 hypothetical protein BAC0308 Protein 1e-31 44
H924_04175 YP_007530184.1 hypothetical protein BAC0197 Protein 5e-31 44
H924_04175 YP_007530184.1 hypothetical protein BAC0125 Protein 6e-31 43
H924_04175 YP_007530184.1 hypothetical protein NC_003923.1003749.p0 Protein 1e-36 43
H924_04175 YP_007530184.1 hypothetical protein AE000516.2.gene3505. Protein 3e-33 43
H924_04175 YP_007530184.1 hypothetical protein NC_002952.2859905.p0 Protein 1e-36 42
H924_04175 YP_007530184.1 hypothetical protein NC_009782.5559369.p0 Protein 1e-36 42
H924_04175 YP_007530184.1 hypothetical protein NC_007793.3914279.p0 Protein 1e-36 42
H924_04175 YP_007530184.1 hypothetical protein NC_002758.1121668.p0 Protein 1e-36 42
H924_04175 YP_007530184.1 hypothetical protein NC_007622.3794472.p0 Protein 1e-36 42
H924_04175 YP_007530184.1 hypothetical protein NC_009641.5332272.p0 Protein 1e-36 42
H924_04175 YP_007530184.1 hypothetical protein NC_013450.8614421.p0 Protein 1e-36 42
H924_04175 YP_007530184.1 hypothetical protein NC_002951.3237708.p0 Protein 1e-36 42
H924_04175 YP_007530184.1 hypothetical protein NC_002745.1124361.p0 Protein 1e-36 42
H924_04175 YP_007530184.1 hypothetical protein NC_007622.3794948.p0 Protein 4e-31 41
H924_04175 YP_007530184.1 hypothetical protein NC_003923.1003417.p0 Protein 4e-31 41
H924_04175 YP_007530184.1 hypothetical protein NC_013450.8614146.p0 Protein 4e-31 41
H924_04175 YP_007530184.1 hypothetical protein NC_002951.3238224.p0 Protein 4e-31 41
H924_04175 YP_007530184.1 hypothetical protein NC_007793.3914065.p0 Protein 4e-31 41
H924_04175 YP_007530184.1 hypothetical protein NC_002758.1121390.p0 Protein 4e-31 41
H924_04175 YP_007530184.1 hypothetical protein NC_010079.5776364.p0 Protein 4e-31 41
H924_04175 YP_007530184.1 hypothetical protein NC_002952.2859858.p0 Protein 4e-31 41
H924_04175 YP_007530184.1 hypothetical protein AF155139.2.orf0.gene Protein 2e-31 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
H924_04175 YP_007530184.1 hypothetical protein VFG1390 Protein 5e-71 71
H924_04175 YP_007530184.1 hypothetical protein VFG1386 Protein 1e-41 48
H924_04175 YP_007530184.1 hypothetical protein VFG1389 Protein 1e-37 47
H924_04175 YP_007530184.1 hypothetical protein VFG0596 Protein 7e-34 45