Gene Information

Name : H924_03410 (H924_03410)
Accession : YP_007530033.1
Strain : Corynebacterium callunae DSM 20147
Genome accession: NC_020506
Putative virulence/resistance : Virulence
Product : response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 720795 - 721475 bp
Length : 681 bp
Strand : +
Note : COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain

DNA sequence :
ATGCCGCAGAAAATTCTCGTCGTTGATGATGATCCCGCAATCTCAGAAATGCTCACCATCGTGCTCAGCGCCGAAGGTTT
TGACACCGTTGCCGTCACCGACGGAGCGCTCGCTGTAGAAACCGCCGTGCGTGAGCAACCCGATCTCATCCTGCTTGACC
TGATGCTGCCCGGCATGAACGGTATTGATATCTGCCGCTCCATCCGCCAAGATTCCGCCGTTCCAATCATCATGCTCACC
GCCAAAACCGACACTGTTGACGTGGTGCTCGGTTTGGAATCCGGTGCCGATGACTATGTGAACAAGCCATTTAAGGCAAA
GGAATTGGTAGCTCGAATCCGAGCTCGCCTGCGTGCCACCGTCGAAGAACCCGGTGAAATCCTCGAGGTCGGGGATCTTT
CGATTGACGTCCCGGGACATACCGTCAAGCGTGGCGAGGAAGAAATCTCCCTCACTCCGCTGGAATTTGATCTGCTTTTG
GAGCTTGCTCGCAAGCCACAGCAGGTATTCACTCGCGAAGAGCTGCTGGGCAAGGTGTGGGGCTACCGCCATGCTTCTGA
TACACGCTTGGTAAATGTGCATGTGCAGCGTTTGCGCGCCAAGATTGAAAAGGATCCGGAAAACCCTCAAATTGTGCTCA
CCGTACGAGGCGTAGGATATAAAACCGGACATAACGACTAA

Protein sequence :
MPQKILVVDDDPAISEMLTIVLSAEGFDTVAVTDGALAVETAVREQPDLILLDLMLPGMNGIDICRSIRQDSAVPIIMLT
AKTDTVDVVLGLESGADDYVNKPFKAKELVARIRARLRATVEEPGEILEVGDLSIDVPGHTVKRGEEEISLTPLEFDLLL
ELARKPQQVFTREELLGKVWGYRHASDTRLVNVHVQRLRAKIEKDPENPQIVLTVRGVGYKTGHND

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 5e-36 43
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 9e-36 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
H924_03410 YP_007530033.1 response regulator AE000516.2.gene3505. Protein 3e-68 74
H924_03410 YP_007530033.1 response regulator NC_002952.2859905.p0 Protein 1e-42 48
H924_03410 YP_007530033.1 response regulator NC_013450.8614421.p0 Protein 1e-42 48
H924_03410 YP_007530033.1 response regulator NC_007793.3914279.p0 Protein 1e-42 48
H924_03410 YP_007530033.1 response regulator NC_003923.1003749.p0 Protein 9e-43 48
H924_03410 YP_007530033.1 response regulator NC_002745.1124361.p0 Protein 1e-42 48
H924_03410 YP_007530033.1 response regulator NC_009782.5559369.p0 Protein 1e-42 48
H924_03410 YP_007530033.1 response regulator NC_002951.3237708.p0 Protein 1e-42 48
H924_03410 YP_007530033.1 response regulator NC_007622.3794472.p0 Protein 1e-42 48
H924_03410 YP_007530033.1 response regulator NC_002758.1121668.p0 Protein 1e-42 48
H924_03410 YP_007530033.1 response regulator NC_009641.5332272.p0 Protein 1e-42 48
H924_03410 YP_007530033.1 response regulator HE999704.1.gene2815. Protein 4e-41 47
H924_03410 YP_007530033.1 response regulator NC_012469.1.7685629. Protein 2e-41 46
H924_03410 YP_007530033.1 response regulator NC_012469.1.7686381. Protein 8e-39 44
H924_03410 YP_007530033.1 response regulator NC_003923.1003417.p0 Protein 2e-36 43
H924_03410 YP_007530033.1 response regulator NC_013450.8614146.p0 Protein 2e-36 43
H924_03410 YP_007530033.1 response regulator NC_002951.3238224.p0 Protein 2e-36 43
H924_03410 YP_007530033.1 response regulator NC_007793.3914065.p0 Protein 2e-36 43
H924_03410 YP_007530033.1 response regulator NC_002758.1121390.p0 Protein 2e-36 43
H924_03410 YP_007530033.1 response regulator NC_010079.5776364.p0 Protein 2e-36 43
H924_03410 YP_007530033.1 response regulator NC_002952.2859858.p0 Protein 2e-36 43
H924_03410 YP_007530033.1 response regulator NC_007622.3794948.p0 Protein 2e-36 43
H924_03410 YP_007530033.1 response regulator BAC0125 Protein 2e-31 43
H924_03410 YP_007530033.1 response regulator BAC0111 Protein 1e-26 42
H924_03410 YP_007530033.1 response regulator AE016830.1.gene1681. Protein 5e-39 42
H924_03410 YP_007530033.1 response regulator AE015929.1.gene1106. Protein 2e-31 41
H924_03410 YP_007530033.1 response regulator HE999704.1.gene1528. Protein 1e-31 41
H924_03410 YP_007530033.1 response regulator CP000675.2.gene1535. Protein 2e-33 41
H924_03410 YP_007530033.1 response regulator AF155139.2.orf0.gene Protein 3e-33 41
H924_03410 YP_007530033.1 response regulator CP004022.1.gene3215. Protein 3e-26 41
H924_03410 YP_007530033.1 response regulator CP001918.1.gene5135. Protein 2e-17 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
H924_03410 YP_007530033.1 response regulator VFG1702 Protein 2e-36 43
H924_03410 YP_007530033.1 response regulator VFG1563 Protein 5e-36 43
H924_03410 YP_007530033.1 response regulator VFG1390 Protein 8e-32 42
H924_03410 YP_007530033.1 response regulator VFG1389 Protein 7e-27 41