Gene Information

Name : terD3 (BN159_5983)
Accession : YP_007524489.1
Strain : Streptomyces davawensis JCM 4913
Genome accession: NC_020504
Putative virulence/resistance : Resistance
Product : Tellurium resistance protein TerD
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 6708222 - 6708797 bp
Length : 576 bp
Strand : +
Note : -

DNA sequence :
ATGGGCGTCACGCTCGCCAAGGGGGGCAATGTCTCCCTGTCCAAGGCCGCACCGAACCTCACCCAGGTGATGATCGGGCT
CGGCTGGGACGCGCGCTCCACCACCGGAGCCCCCTTCGACCTCGACGCCAGCGCGCTGATGTGCAACGGCGGACGGGTGA
TGGGGGATGAGTGGTTCATCTTCTACAACCAGCTCAAGAGCCCGGACGGCTCCGTGGAGCACACCGGCGACAACCTCACC
GGCGAGGGCGACGGCGACGACGAGTCGCTGCTGATCGACCTCGCCAAGGTGCCCGCCCAGTGCGACAAGATCGTCTTCCC
CGTCTCGATCCATATGGCCGATGAGCGTGGCCAGACGTTCGGGCAGGTCAGCAACGCCTTCATCCGCGTGGTGAACCAGG
CCGACGGTCAGGAACTGGCCCGCTACGACCTCAGCGAGGACGCCTCCACCGAGACGGCGATGATCTTCGGCGAGGTCTAC
CGGTACCAGGGCGAGTGGAAGTTCCGTGCGGTCGGGCAGGGGTACGCGTCGGGGCTGCGCGGCATCGCCCTGGACTTCGG
GGTCAACGTCTCATAA

Protein sequence :
MGVTLAKGGNVSLSKAAPNLTQVMIGLGWDARSTTGAPFDLDASALMCNGGRVMGDEWFIFYNQLKSPDGSVEHTGDNLT
GEGDGDDESLLIDLAKVPAQCDKIVFPVSIHMADERGQTFGQVSNAFIRVVNQADGQELARYDLSEDASTETAMIFGEVY
RYQGEWKFRAVGQGYASGLRGIALDFGVNVS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 5e-57 67
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 5e-57 67
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 1e-56 67
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 1e-59 65
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 8e-52 61
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-51 61
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-51 61
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 1e-52 59
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 8e-26 42
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 8e-26 42
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 7e-27 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
terD3 YP_007524489.1 Tellurium resistance protein TerD BAC0389 Protein 2e-56 66
terD3 YP_007524489.1 Tellurium resistance protein TerD BAC0390 Protein 2e-55 61
terD3 YP_007524489.1 Tellurium resistance protein TerD BAC0392 Protein 1e-25 41