Gene Information

Name : terD1 (BN159_5982)
Accession : YP_007524488.1
Strain : Streptomyces davawensis JCM 4913
Genome accession: NC_020504
Putative virulence/resistance : Resistance
Product : Tellurium resistance protein TerD
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 6707537 - 6708112 bp
Length : 576 bp
Strand : +
Note : -

DNA sequence :
GTGGGAGTCAGCCTCAGCAAGGGCGGCAACGTATCGCTGACCAAGGAGGCCCCTGGCCTCACTGCGGTCATCGTCGGTCT
GGGGTGGGACATCCGCACCACCACCGGCACCGACTTCGACCTGGACGCCAGCGCACTGCTGCTGAACTCGTCCGGCAAGG
TCGCGAGCGACGCGCACTTCATCTTCTTCAACAACCTCAAGAGCCCGGACGGCTCCGTCGAACACACCGGTGACAACCTC
ACCGGTGAGGGCGAGGGCGACGACGAGCAGATCAAGATCAACCTCGTCGGTGTCCCGGCTGACGTCGAGAAGATCGTCTT
CCCGGTGTCGATCTACGACGCCGAGAACCGCCAGCAGTCCTTCGGCCAGGTGCGCAACGCGTTCATCCGCGTCGTGAACC
AGGCCGGCGAGGCGGAGATCGCCCGCTACGACCTCAGCGAGGACGCCTCCACCGAGACCGCCATGGTCTTCGGTGAGCTC
TACCGCCACGGCGCGGAGTGGAAGTTCCGCGCCATCGGCCAGGGCTACGCCTCGGGCCTGCGCGGTATCGCGCAGGACTT
CGGCGTCAACGTCTGA

Protein sequence :
MGVSLSKGGNVSLTKEAPGLTAVIVGLGWDIRTTTGTDFDLDASALLLNSSGKVASDAHFIFFNNLKSPDGSVEHTGDNL
TGEGEGDDEQIKINLVGVPADVEKIVFPVSIYDAENRQQSFGQVRNAFIRVVNQAGEAEIARYDLSEDASTETAMVFGEL
YRHGAEWKFRAIGQGYASGLRGIAQDFGVNV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 6e-59 69
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-56 68
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-56 68
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 2e-56 68
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 3e-57 67
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-57 67
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-57 67
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 3e-54 66
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-24 43
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-24 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
terD1 YP_007524488.1 Tellurium resistance protein TerD BAC0389 Protein 2e-57 67
terD1 YP_007524488.1 Tellurium resistance protein TerD BAC0390 Protein 2e-56 65
terD1 YP_007524488.1 Tellurium resistance protein TerD BAC0392 Protein 9e-24 42