Gene Information

Name : pcoR (BN159_3013)
Accession : YP_007521519.1
Strain : Streptomyces davawensis JCM 4913
Genome accession: NC_020504
Putative virulence/resistance : Resistance
Product : Transcriptional regulatory protein pcoR
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3428305 - 3428967 bp
Length : 663 bp
Strand : -
Note : -

DNA sequence : 
ATGCGCCTGTTGATCGTGGAGGACGAGAAGCGGCTTGCCCTCTCGCTCGCCAAGGGGCTGACCGCCGAGGGATACGCCGT
GGACGTCGTGCACGACGGGCGCGAAGGGCTGCACCGGGCGAGCGAGTCGCCGTACGACCTCGTCATCCTCGACATCATGC
TGCCGGGGATGAACGGCTACCGCGTGTGCGGTGCGCTCCGGGCCGCCGGGCACGACGTGCCGATCCTGATGCTGACCGCC
AAGGACGGGGAGTACGACGAGGCGGAGGGGCTGGACACGGGGGCTGATGACTATCTCACCAAGCCGTTTTCGTATGTCGT
GCTCGTCGCCCGGATCAAGGCGCTGCTGCGGCGGCGCGGGCCCGGTGCCTCACCCGTGCTCGTGCACGGGGATCTGAAGG
TCGACACCGCCGCCCGCCGCGTCCACCTCGGGGAGAGCGAAGTCGCGCTCACCGCCAAGGAGTTCGCCGTTCTTGAGCAA
CTCGTCACTCGGGCCGGTGAGGTCGTCTCCAAGGCGAGCATCCTGGAGCACGTCTGGGACTTCGCCTACGACGGCGACCC
CAACATCGTCGAGGTCTACATCAGCACCCTGCGCCGCAAGCTCCGCCCCGGCCTCATCCGTACCGTCCGCGGCGCCGGGT
ACCGGCTGGAGTCGGGCCGATGA

Protein sequence : 
MRLLIVEDEKRLALSLAKGLTAEGYAVDVVHDGREGLHRASESPYDLVILDIMLPGMNGYRVCGALRAAGHDVPILMLTA
KDGEYDEAEGLDTGADDYLTKPFSYVVLVARIKALLRRRGPGASPVLVHGDLKVDTAARRVHLGESEVALTAKEFAVLEQ
LVTRAGEVVSKASILEHVWDFAYDGDPNIVEVYISTLRRKLRPGLIRTVRGAGYRLESGR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 4e-40 44
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-39 43
vanRB NP_815956.1 DNA-binding response regulator VanRB Not tested Not named Protein 1e-34 42
vanRB YP_008394254.1 DNA-binding response regulator VanRB Not tested Not named Protein 3e-35 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
pcoR YP_007521519.1 Transcriptional regulatory protein pcoR BAC0197 Protein 2e-42 48
pcoR YP_007521519.1 Transcriptional regulatory protein pcoR BAC0083 Protein 2e-42 47
pcoR YP_007521519.1 Transcriptional regulatory protein pcoR BAC0308 Protein 7e-45 47
pcoR YP_007521519.1 Transcriptional regulatory protein pcoR BAC0125 Protein 2e-42 45
pcoR YP_007521519.1 Transcriptional regulatory protein pcoR BAC0111 Protein 1e-41 45
pcoR YP_007521519.1 Transcriptional regulatory protein pcoR U82965.2.orf14.gene. Protein 3e-30 45
pcoR YP_007521519.1 Transcriptional regulatory protein pcoR NC_013450.8614146.p0 Protein 6e-39 44
pcoR YP_007521519.1 Transcriptional regulatory protein pcoR NC_002951.3238224.p0 Protein 6e-39 44
pcoR YP_007521519.1 Transcriptional regulatory protein pcoR NC_007793.3914065.p0 Protein 6e-39 44
pcoR YP_007521519.1 Transcriptional regulatory protein pcoR NC_002758.1121390.p0 Protein 6e-39 44
pcoR YP_007521519.1 Transcriptional regulatory protein pcoR NC_010079.5776364.p0 Protein 6e-39 44
pcoR YP_007521519.1 Transcriptional regulatory protein pcoR NC_002952.2859858.p0 Protein 6e-39 44
pcoR YP_007521519.1 Transcriptional regulatory protein pcoR NC_007622.3794948.p0 Protein 6e-39 44
pcoR YP_007521519.1 Transcriptional regulatory protein pcoR NC_003923.1003417.p0 Protein 6e-39 44
pcoR YP_007521519.1 Transcriptional regulatory protein pcoR Y16952.3.orf35.gene. Protein 6e-24 44
pcoR YP_007521519.1 Transcriptional regulatory protein pcoR BAC0638 Protein 2e-37 44
pcoR YP_007521519.1 Transcriptional regulatory protein pcoR AE015929.1.gene1106. Protein 1e-34 43
pcoR YP_007521519.1 Transcriptional regulatory protein pcoR AE016830.1.gene2255. Protein 5e-35 42
pcoR YP_007521519.1 Transcriptional regulatory protein pcoR U35369.1.gene1.p01 Protein 5e-35 42
pcoR YP_007521519.1 Transcriptional regulatory protein pcoR NC_002952.2859905.p0 Protein 4e-39 42
pcoR YP_007521519.1 Transcriptional regulatory protein pcoR BAC0347 Protein 1e-34 42
pcoR YP_007521519.1 Transcriptional regulatory protein pcoR NC_009782.5559369.p0 Protein 6e-39 42
pcoR YP_007521519.1 Transcriptional regulatory protein pcoR NC_002951.3237708.p0 Protein 6e-39 42
pcoR YP_007521519.1 Transcriptional regulatory protein pcoR NC_007622.3794472.p0 Protein 4e-39 42
pcoR YP_007521519.1 Transcriptional regulatory protein pcoR NC_002758.1121668.p0 Protein 6e-39 42
pcoR YP_007521519.1 Transcriptional regulatory protein pcoR NC_009641.5332272.p0 Protein 6e-39 42
pcoR YP_007521519.1 Transcriptional regulatory protein pcoR NC_013450.8614421.p0 Protein 6e-39 42
pcoR YP_007521519.1 Transcriptional regulatory protein pcoR NC_007793.3914279.p0 Protein 6e-39 42
pcoR YP_007521519.1 Transcriptional regulatory protein pcoR NC_003923.1003749.p0 Protein 6e-39 42
pcoR YP_007521519.1 Transcriptional regulatory protein pcoR NC_002745.1124361.p0 Protein 6e-39 42
pcoR YP_007521519.1 Transcriptional regulatory protein pcoR NC_002516.2.879194.p Protein 1e-29 42
pcoR YP_007521519.1 Transcriptional regulatory protein pcoR AF310956.2.orf0.gene Protein 1e-35 41
pcoR YP_007521519.1 Transcriptional regulatory protein pcoR FJ349556.1.orf0.gene Protein 4e-36 41
pcoR YP_007521519.1 Transcriptional regulatory protein pcoR AE000516.2.gene3505. Protein 3e-31 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
pcoR YP_007521519.1 Transcriptional regulatory protein pcoR VFG0596 Protein 1e-40 44
pcoR YP_007521519.1 Transcriptional regulatory protein pcoR VFG1389 Protein 2e-39 44
pcoR YP_007521519.1 Transcriptional regulatory protein pcoR VFG1390 Protein 6e-43 43
pcoR YP_007521519.1 Transcriptional regulatory protein pcoR VFG1386 Protein 3e-37 43