Gene Information

Name : cheY (HydHO_1146)
Accession : YP_007500504.1
Strain : Hydrogenobaculum sp. HO
Genome accession: NC_020411
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator, winged helix family, CheY
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1057108 - 1057785 bp
Length : 678 bp
Strand : +
Note : IMG reference gene:2506378062; PFAM: Response regulator receiver domain; Transcriptional regulatory protein, C terminal; PFAM: response regulator receiver; transcriptional regulator domain-containing protein; SMART: response regulator receiver; SPTR: Two

DNA sequence :
ATGAGTCTTAAAGCTCTTATAGTAGAAGATGATGAGCTTTTACTAGAAACGTTAGAAAAGGGGTTTAGACACGAGGGATT
TGAAGTAGATATAGCAAAAGACGGCTTTCAGGCTCTTCAAAAGGCAAAAACAAACAGCTACGATATCATAATTCTCGATG
TTGTAATTCCCAAAATAGACGGTGTAAAAGTATGTAAACAGTTAAGACTTCAAAGTGAAATCCCCATTATTATGCTAACG
GCAAAATCCCAGCTAGAGGATAAGCTAGAGGGCCTTGAAGCAGGAGCAGACGATTACATCACAAAGCCCTTTTCTTTTAA
AGAACTGATAATGAGGGTAAAAACCGTTTTAAGACGTTATAACAAAGTGCAAGAAGAAAAGATAGTTTTAAAAGACCTCA
CAATGGATTTAAAAGATTTTAAAGTGTTTTATAAAGGAAAAGCCATAAACCTTACACCAAAAGAGTTTGAGCTTTTAAAA
GTTTTAGCTCAAAATCCAAACAAGATCATAAGAAGAGAAGTGCTATTAAACAAAGTATGGGGCATAGCCTCCGATTACGA
TTCAAACATCGTAGATGTCTATATAAAAAATATTCGGAACAAACTAGACGACAAACCCCCAAAACTCATCCTCACCATAA
GAGGAAGAGGCTATATGCTAAGCACAGAGCAAAGTTGA

Protein sequence :
MSLKALIVEDDELLLETLEKGFRHEGFEVDIAKDGFQALQKAKTNSYDIIILDVVIPKIDGVKVCKQLRLQSEIPIIMLT
AKSQLEDKLEGLEAGADDYITKPFSFKELIMRVKTVLRRYNKVQEEKIVLKDLTMDLKDFKVFYKGKAINLTPKEFELLK
VLAQNPNKIIRREVLLNKVWGIASDYDSNIVDVYIKNIRNKLDDKPPKLILTIRGRGYMLSTEQS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 6e-34 43
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-33 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
cheY YP_007500504.1 two component transcriptional regulator, winged helix family, CheY AE015929.1.gene1106. Protein 6e-35 46
cheY YP_007500504.1 two component transcriptional regulator, winged helix family, CheY NC_010079.5776364.p0 Protein 4e-39 46
cheY YP_007500504.1 two component transcriptional regulator, winged helix family, CheY NC_002952.2859858.p0 Protein 4e-39 46
cheY YP_007500504.1 two component transcriptional regulator, winged helix family, CheY NC_007622.3794948.p0 Protein 4e-39 46
cheY YP_007500504.1 two component transcriptional regulator, winged helix family, CheY NC_003923.1003417.p0 Protein 4e-39 46
cheY YP_007500504.1 two component transcriptional regulator, winged helix family, CheY NC_013450.8614146.p0 Protein 4e-39 46
cheY YP_007500504.1 two component transcriptional regulator, winged helix family, CheY NC_002951.3238224.p0 Protein 4e-39 46
cheY YP_007500504.1 two component transcriptional regulator, winged helix family, CheY NC_007793.3914065.p0 Protein 4e-39 46
cheY YP_007500504.1 two component transcriptional regulator, winged helix family, CheY NC_002758.1121390.p0 Protein 4e-39 46
cheY YP_007500504.1 two component transcriptional regulator, winged helix family, CheY NC_002952.2859905.p0 Protein 6e-34 45
cheY YP_007500504.1 two component transcriptional regulator, winged helix family, CheY NC_002951.3237708.p0 Protein 4e-34 45
cheY YP_007500504.1 two component transcriptional regulator, winged helix family, CheY NC_007622.3794472.p0 Protein 6e-34 45
cheY YP_007500504.1 two component transcriptional regulator, winged helix family, CheY NC_002758.1121668.p0 Protein 4e-34 45
cheY YP_007500504.1 two component transcriptional regulator, winged helix family, CheY NC_009641.5332272.p0 Protein 4e-34 45
cheY YP_007500504.1 two component transcriptional regulator, winged helix family, CheY NC_013450.8614421.p0 Protein 4e-34 45
cheY YP_007500504.1 two component transcriptional regulator, winged helix family, CheY NC_007793.3914279.p0 Protein 4e-34 45
cheY YP_007500504.1 two component transcriptional regulator, winged helix family, CheY NC_003923.1003749.p0 Protein 4e-34 45
cheY YP_007500504.1 two component transcriptional regulator, winged helix family, CheY NC_002745.1124361.p0 Protein 4e-34 45
cheY YP_007500504.1 two component transcriptional regulator, winged helix family, CheY NC_009782.5559369.p0 Protein 4e-34 45
cheY YP_007500504.1 two component transcriptional regulator, winged helix family, CheY NC_012469.1.7686381. Protein 1e-31 44
cheY YP_007500504.1 two component transcriptional regulator, winged helix family, CheY NC_012469.1.7685629. Protein 4e-28 43
cheY YP_007500504.1 two component transcriptional regulator, winged helix family, CheY AE000516.2.gene3505. Protein 3e-34 43
cheY YP_007500504.1 two component transcriptional regulator, winged helix family, CheY BAC0125 Protein 3e-37 42
cheY YP_007500504.1 two component transcriptional regulator, winged helix family, CheY BAC0111 Protein 1e-34 42
cheY YP_007500504.1 two component transcriptional regulator, winged helix family, CheY BAC0308 Protein 2e-32 42
cheY YP_007500504.1 two component transcriptional regulator, winged helix family, CheY BAC0197 Protein 1e-34 42
cheY YP_007500504.1 two component transcriptional regulator, winged helix family, CheY HE999704.1.gene2815. Protein 2e-30 42
cheY YP_007500504.1 two component transcriptional regulator, winged helix family, CheY AF155139.2.orf0.gene Protein 2e-28 41
cheY YP_007500504.1 two component transcriptional regulator, winged helix family, CheY AE016830.1.gene1681. Protein 6e-32 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
cheY YP_007500504.1 two component transcriptional regulator, winged helix family, CheY VFG0596 Protein 2e-34 43
cheY YP_007500504.1 two component transcriptional regulator, winged helix family, CheY VFG1389 Protein 2e-36 42