Gene Information

Name : yceE (BAM5036_0276)
Accession : YP_007496011.1
Strain : Bacillus amyloliquefaciens UCMB5036
Genome accession: NC_020410
Putative virulence/resistance : Resistance
Product : putative stress adaptation protein / Uncharacterized proteins involved in stress response,homologs of TerZ and putative cAMP-binding protein CABP1
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 290908 - 291486 bp
Length : 579 bp
Strand : +
Note : Evidence 3 : Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; Product type pf : putative factor

DNA sequence :
ATGGCTATTCAATTGGCGAAAGGACAGCGTGTTGATCTGACAAAAACGAACCCCGGCCTTACAAAAGCGGTGATCGGCTT
AGGGTGGGATACGAACAAGTACTCCGGAGGGCATGACTTTGACCTTGACGCGTCGGCTTTTCTTGTCGATGCCCATGACA
ACTGTGTAAATGATCTTGATTTTGTTTTCTACAATAACCTGGAACACCCGAGCGGGGGCGTCATCCATACGGGAGACAAC
CGGACGGGCGAGGGCGAGGGAGACGATGAACAAATTATCGTCGACTTCTCAAAAATACCCGCAAATATTGAAAAGATCGG
CATCACCGTCACGATTCATGATGCGGAAGCGCGCGGCCAAAATTTCGGACAAGTTTCGAACGCGTTCGTGCGCGTCGTCG
ATGAAAACAGCCAGAATGAACTGCTTCGTTTCGATTTAGGGGAAGACTTCTCGATTGAAACGGCGGTTGTCGTTTGTGAG
CTTTACCGCCATGGGGCTGAGTGGAAGTTTAACGCCATCGGCAGCGGGTTTTCCGGCGGTCTGGCATCACTTTGCCGGAA
TTACGGCTTGCAGGTGTAA

Protein sequence :
MAIQLAKGQRVDLTKTNPGLTKAVIGLGWDTNKYSGGHDFDLDASAFLVDAHDNCVNDLDFVFYNNLEHPSGGVIHTGDN
RTGEGEGDDEQIIVDFSKIPANIEKIGITVTIHDAEARGQNFGQVSNAFVRVVDENSQNELLRFDLGEDFSIETAVVVCE
LYRHGAEWKFNAIGSGFSGGLASLCRNYGLQV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 3e-53 56
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 2e-47 54
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-47 54
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-47 54
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-51 53
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-51 53
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 7e-51 52
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 6e-45 50
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 2e-27 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
yceE YP_007496011.1 putative stress adaptation protein / Uncharacterized proteins involved in stress response,homologs of TerZ and putative cAMP-binding protein CABP1 BAC0390 Protein 2e-51 55
yceE YP_007496011.1 putative stress adaptation protein / Uncharacterized proteins involved in stress response,homologs of TerZ and putative cAMP-binding protein CABP1 BAC0389 Protein 2e-51 53