Gene Information

Name : yceD (BAM5036_0275)
Accession : YP_007496010.1
Strain : Bacillus amyloliquefaciens UCMB5036
Genome accession: NC_020410
Putative virulence/resistance : Resistance
Product : putative stress adaptation protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 290294 - 290875 bp
Length : 582 bp
Strand : +
Note : Evidence 3 : Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; Product type pf : putative factor

DNA sequence : 
ATGGCAATTTCATTGGCAAAAGGACAAAAAGTAGATTTGACTAAAACAAATCCGGGTCTTTCTAAAGTCGTTGTCGGCCT
TGGCTGGGATACAAACAAATACGACGGCGGACATGATTTTGATTTAGATTCCAGCGTCTTTCTATTAAATGAAGCGGGAA
AATGCGCGTCGCCTGATGATTTCATTTTCTATAATCAGCTTGAAGGCGGAAACGGCTCTGTCGCACATTCAGGCGACAAC
CTGACAGGCCAGGGCGAAGGCGATGACGAAAGCGTAAGAGTCAACCTGAGCGCGGTGCCCGCGGCTATTGACAAAATTTC
ATTTGTCATCACGATTCATGAAGCGGAAGCGCGCGGCCAAAACTTCGGACAAGTTTCCAACGCGTTCGTGCGCATTGTCA
ATGAAGAGACAAATGAGGAGCTGATCCGCTATGATCTGGCTGAAGATTTCTCAATTGAAACAGCCATTATCGCAGGGGAG
CTTTACAGACATAATGGCGAATGGAAATTTTCCGCGATCGGCTCAGGCTACCAAGGCGGACTGGCCCGTATTGCGACAGA
TTACGGCCTGCAAATCGGCTGA

Protein sequence : 
MAISLAKGQKVDLTKTNPGLSKVVVGLGWDTNKYDGGHDFDLDSSVFLLNEAGKCASPDDFIFYNQLEGGNGSVAHSGDN
LTGQGEGDDESVRVNLSAVPAAIDKISFVITIHEAEARGQNFGQVSNAFVRIVNEETNEELIRYDLAEDFSIETAIIAGE
LYRHNGEWKFSAIGSGYQGGLARIATDYGLQIG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 8e-56 60
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 2e-55 57
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 6e-56 57
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 6e-56 57
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 3e-47 53
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-46 51
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-46 51
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 2e-46 51
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 5e-31 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
yceD YP_007496010.1 putative stress adaptation protein BAC0389 Protein 9e-56 58
yceD YP_007496010.1 putative stress adaptation protein BAC0390 Protein 4e-51 54
yceD YP_007496010.1 putative stress adaptation protein BAC0392 Protein 7e-28 41