Gene Information

Name : btf_1009 (btf_1009)
Accession : YP_007485428.1
Strain : Dehalococcoides mccartyi BTF08
Genome accession: NC_020387
Putative virulence/resistance : Virulence
Product : signal transduction response regulator, OmpR family
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 927795 - 928478 bp
Length : 684 bp
Strand : +
Note : -

DNA sequence :
ATGTCCAAGAAAATACTGATAGCTGATGATGAAAAAAGGATAGCGGAAATCCTGCAAGCCTATTTGGAACGTGAAGGCTT
CAGGGTGATAGCTACTTATGACGGCAAGACAGCCTTAGCCAAATTTCACGAAGAAAACCCTGACCTGATAATACTTGACC
TGATGCTGCCTGAAATATCCGGCTGGGATGTCTGCCGCGAAATCCGCAAGGAAAGCCGTGTACCTATAATAATGCTTACC
GCCCGTGACGAACTCACCGACAAGCTTATAGGACTGGAAATTGGGGCGGATGATTATATGACCAAGCCCTTTGAGTCCAA
GGAACTGGTAGCCCGCGTCAAAGTCCAGCTCAGACGGTCTGAATACCCCCCCAGCCCTGATTCAGCACTGGTTATTGACC
AACTGGAGATAGATCAGGAACGGCGTCTGGTCAAGATTGATGGCAAAACTGTAGACCTGACCGCCACCGAATTTGATATA
TTGATAAGCTTGGCCGTAAGTCCGGGTCGGGTTTTTTCCCGTATGCAGATATTGGACAAGCTGGGCGAAGCTTACGAAGG
ATATGAACGCACCATAGACAGCCATATTAAAAATCTACGAAAAAAAATAGAGCCTAACCTCGAATCCCCTACCTATATCC
TGACCGTACACGGGGTGGGCTACAAGATGAAAGACAGAGGATAA

Protein sequence :
MSKKILIADDEKRIAEILQAYLEREGFRVIATYDGKTALAKFHEENPDLIILDLMLPEISGWDVCREIRKESRVPIIMLT
ARDELTDKLIGLEIGADDYMTKPFESKELVARVKVQLRRSEYPPSPDSALVIDQLEIDQERRLVKIDGKTVDLTATEFDI
LISLAVSPGRVFSRMQILDKLGEAYEGYERTIDSHIKNLRKKIEPNLESPTYILTVHGVGYKMKDRG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 1e-34 42
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 2e-35 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
btf_1009 YP_007485428.1 signal transduction response regulator, OmpR family NC_012469.1.7685629. Protein 3e-44 48
btf_1009 YP_007485428.1 signal transduction response regulator, OmpR family AE000516.2.gene3505. Protein 6e-36 46
btf_1009 YP_007485428.1 signal transduction response regulator, OmpR family HE999704.1.gene2815. Protein 7e-40 45
btf_1009 YP_007485428.1 signal transduction response regulator, OmpR family AM180355.1.gene1830. Protein 8e-37 44
btf_1009 YP_007485428.1 signal transduction response regulator, OmpR family FJ349556.1.orf0.gene Protein 4e-35 44
btf_1009 YP_007485428.1 signal transduction response regulator, OmpR family AF155139.2.orf0.gene Protein 4e-38 44
btf_1009 YP_007485428.1 signal transduction response regulator, OmpR family BAC0039 Protein 2e-40 44
btf_1009 YP_007485428.1 signal transduction response regulator, OmpR family CP000034.1.gene2186. Protein 2e-40 44
btf_1009 YP_007485428.1 signal transduction response regulator, OmpR family NC_002695.1.916589.p Protein 2e-40 44
btf_1009 YP_007485428.1 signal transduction response regulator, OmpR family BAC0596 Protein 1e-40 44
btf_1009 YP_007485428.1 signal transduction response regulator, OmpR family CP001138.1.gene2239. Protein 1e-40 44
btf_1009 YP_007485428.1 signal transduction response regulator, OmpR family AF162694.1.orf4.gene Protein 5e-32 43
btf_1009 YP_007485428.1 signal transduction response regulator, OmpR family NC_005054.2598277.p0 Protein 2e-36 43
btf_1009 YP_007485428.1 signal transduction response regulator, OmpR family NC_014475.1.orf0.gen Protein 2e-36 43
btf_1009 YP_007485428.1 signal transduction response regulator, OmpR family NC_010400.5986590.p0 Protein 6e-38 43
btf_1009 YP_007485428.1 signal transduction response regulator, OmpR family NC_010410.6002989.p0 Protein 2e-38 43
btf_1009 YP_007485428.1 signal transduction response regulator, OmpR family NC_011595.7057856.p0 Protein 2e-38 43
btf_1009 YP_007485428.1 signal transduction response regulator, OmpR family NC_002952.2859905.p0 Protein 4e-39 43
btf_1009 YP_007485428.1 signal transduction response regulator, OmpR family NC_007622.3794472.p0 Protein 4e-39 43
btf_1009 YP_007485428.1 signal transduction response regulator, OmpR family NC_002745.1124361.p0 Protein 6e-39 43
btf_1009 YP_007485428.1 signal transduction response regulator, OmpR family NC_009782.5559369.p0 Protein 6e-39 43
btf_1009 YP_007485428.1 signal transduction response regulator, OmpR family NC_002951.3237708.p0 Protein 6e-39 43
btf_1009 YP_007485428.1 signal transduction response regulator, OmpR family NC_003923.1003749.p0 Protein 5e-39 43
btf_1009 YP_007485428.1 signal transduction response regulator, OmpR family NC_002758.1121668.p0 Protein 6e-39 43
btf_1009 YP_007485428.1 signal transduction response regulator, OmpR family NC_009641.5332272.p0 Protein 6e-39 43
btf_1009 YP_007485428.1 signal transduction response regulator, OmpR family NC_013450.8614421.p0 Protein 6e-39 43
btf_1009 YP_007485428.1 signal transduction response regulator, OmpR family NC_007793.3914279.p0 Protein 6e-39 43
btf_1009 YP_007485428.1 signal transduction response regulator, OmpR family CP001918.1.gene3444. Protein 1e-39 43
btf_1009 YP_007485428.1 signal transduction response regulator, OmpR family CP004022.1.gene1676. Protein 2e-36 43
btf_1009 YP_007485428.1 signal transduction response regulator, OmpR family CP000647.1.gene2531. Protein 6e-40 43
btf_1009 YP_007485428.1 signal transduction response regulator, OmpR family DQ212986.1.gene4.p01 Protein 1e-36 42
btf_1009 YP_007485428.1 signal transduction response regulator, OmpR family CP000675.2.gene1535. Protein 1e-41 42
btf_1009 YP_007485428.1 signal transduction response regulator, OmpR family AE015929.1.gene1106. Protein 2e-27 41
btf_1009 YP_007485428.1 signal transduction response regulator, OmpR family EU250284.1.orf4.gene Protein 3e-33 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
btf_1009 YP_007485428.1 signal transduction response regulator, OmpR family VFG1563 Protein 7e-35 42
btf_1009 YP_007485428.1 signal transduction response regulator, OmpR family VFG1702 Protein 8e-36 42