Gene Information

Name : Cspa_c29570 (Cspa_c29570)
Accession : YP_007455972.1
Strain : Clostridium saccharoperbutylacetonicum N1-4(HMT)
Genome accession: NC_020291
Putative virulence/resistance : Virulence
Product : Two component transcriptional regulator, winged helix family
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3224346 - 3225026 bp
Length : 681 bp
Strand : +
Note : -

DNA sequence :
ATGGTTAAGATTTTAATTGTTGAAGATGATGAAAAACTGGCAAGATTTGTAGAATTAGAGTTAGTACATGAAGGCTATGA
AATATTAAAAGCAGATAATGGAAGAACTGGTCTTGAAATTGCAGAAAATGGGCAAGTCGATTTAATTCTTTTAGATATAA
TGATTCCAGAAATAAATGGCTTGGAAGTATTACGTAGAATAAGAAAAGCTTCAGATCTGCCTGTAATAATGTTAACTGCC
AGAGATGCTGTTATGGATAAGGTTTCAGGACTTGATGCAGGTGCAGATGATTATATAACAAAGCCTTTTGCAATAGAAGA
GTTATTGGCTAGAATAAGAACAGCATTAAAGAGACGAAGAGGCAGTGAAAAAATAGATTCTGATATAATAAGCTGTGGAT
TATTATCTCTTGATAAGATAAGGCATAAGGTTATGTATGACAATAAAGAAATAGAATTAACAAACAGAGAATTTATGTTA
TTAAAAATTTTATTGGAAAATAAGAATATAGTACTAAGTAGAGATATACTAATGGAAAAAGTATGTGGCTATGATTTTAT
TGGAGAAACTAATGTAATAGATGTTTACATAAGATATTTAAGAACTAAAATAGATGACATCTTCAAAATAAAGATAATTT
CTACAGTGCGTGGAGTAGGGTATGTTATAAAAGATGAGTAA

Protein sequence :
MVKILIVEDDEKLARFVELELVHEGYEILKADNGRTGLEIAENGQVDLILLDIMIPEINGLEVLRRIRKASDLPVIMLTA
RDAVMDKVSGLDAGADDYITKPFAIEELLARIRTALKRRRGSEKIDSDIISCGLLSLDKIRHKVMYDNKEIELTNREFML
LKILLENKNIVLSRDILMEKVCGYDFIGETNVIDVYIRYLRTKIDDIFKIKIISTVRGVGYVIKDE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 6e-33 43
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-32 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Cspa_c29570 YP_007455972.1 Two component transcriptional regulator, winged helix family HE999704.1.gene1528. Protein 2e-44 55
Cspa_c29570 YP_007455972.1 Two component transcriptional regulator, winged helix family NC_002951.3238224.p0 Protein 2e-44 52
Cspa_c29570 YP_007455972.1 Two component transcriptional regulator, winged helix family NC_007793.3914065.p0 Protein 2e-44 52
Cspa_c29570 YP_007455972.1 Two component transcriptional regulator, winged helix family NC_002758.1121390.p0 Protein 2e-44 52
Cspa_c29570 YP_007455972.1 Two component transcriptional regulator, winged helix family NC_010079.5776364.p0 Protein 2e-44 52
Cspa_c29570 YP_007455972.1 Two component transcriptional regulator, winged helix family NC_002952.2859858.p0 Protein 2e-44 52
Cspa_c29570 YP_007455972.1 Two component transcriptional regulator, winged helix family NC_007622.3794948.p0 Protein 2e-44 52
Cspa_c29570 YP_007455972.1 Two component transcriptional regulator, winged helix family NC_003923.1003417.p0 Protein 2e-44 52
Cspa_c29570 YP_007455972.1 Two component transcriptional regulator, winged helix family NC_013450.8614146.p0 Protein 2e-44 52
Cspa_c29570 YP_007455972.1 Two component transcriptional regulator, winged helix family AE015929.1.gene1106. Protein 2e-41 50
Cspa_c29570 YP_007455972.1 Two component transcriptional regulator, winged helix family BAC0308 Protein 1e-37 46
Cspa_c29570 YP_007455972.1 Two component transcriptional regulator, winged helix family BAC0125 Protein 6e-34 44
Cspa_c29570 YP_007455972.1 Two component transcriptional regulator, winged helix family BAC0111 Protein 2e-32 43
Cspa_c29570 YP_007455972.1 Two component transcriptional regulator, winged helix family BAC0197 Protein 3e-34 43
Cspa_c29570 YP_007455972.1 Two component transcriptional regulator, winged helix family NC_012469.1.7685629. Protein 2e-35 42
Cspa_c29570 YP_007455972.1 Two component transcriptional regulator, winged helix family BAC0083 Protein 6e-33 42
Cspa_c29570 YP_007455972.1 Two component transcriptional regulator, winged helix family BAC0347 Protein 1e-31 42
Cspa_c29570 YP_007455972.1 Two component transcriptional regulator, winged helix family NC_012469.1.7686381. Protein 5e-33 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Cspa_c29570 YP_007455972.1 Two component transcriptional regulator, winged helix family VFG0596 Protein 2e-33 43
Cspa_c29570 YP_007455972.1 Two component transcriptional regulator, winged helix family VFG1389 Protein 5e-36 43
Cspa_c29570 YP_007455972.1 Two component transcriptional regulator, winged helix family VFG1390 Protein 3e-38 41