Gene Information

Name : Cspa_c27970 (Cspa_c27970)
Accession : YP_007455814.1
Strain : Clostridium saccharoperbutylacetonicum N1-4(HMT)
Genome accession: NC_020291
Putative virulence/resistance : Resistance
Product : Two component transcriptional regulator, winged helix family
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3026346 - 3027026 bp
Length : 681 bp
Strand : +
Note : -

DNA sequence :
ATGAAAGAAAATAAAATTTTAGTAGTTGATGATGAACCATTAATAAGAAAGCTTGTTACAGATTTTTTAAAAAAACAAGG
TTATATAACTGTTGAAGCAGAAGATGGTAAAAAGGCTATGGATTTATTTTGGAGTGAGGGAAATATAGATTTAATTATTC
TAGATGTAATGCTTCCAGAATATGATGGATTTACAGTATGCAGAGAAATAAGAAAGAAGTCTAAAGTTCCAATCATAATG
CTTACGGCAAGGGGTGAAGAATTTGACGAAGTTTTTGGTTTAGATATTGGTGCAGATGAATATATTTCAAAGCCTTTTAG
TCCTAATATCTTAATAGCAAGGGTAAATGCAGTTCTTAGAAGAGCAGTAACAGCAGCAGAAACAGATACTGATGTTAAAA
AGTATAATGGATTAATTGTTGATCATAATGCTCATCAAGTTACTATTGATGGATCTATAGTTGATTTAAGTCCAAAAGAA
TATGAGTTGTTAGCTTACTTATCTGAAAATTACGGAAAAGCTTTAAGTAGAGAACAAATTTTAGATAAAGTATGGGGCTA
TGATTATTATGGAGATTTAAGAACAGTAGATACACATATAAATAGATTGAGAATAAAACTTGGTGAAAAGAGCGAATTTA
TTCAAACAGTACGCGGTTATGGTTATAGATTTGAGGAATAA

Protein sequence :
MKENKILVVDDEPLIRKLVTDFLKKQGYITVEAEDGKKAMDLFWSEGNIDLIILDVMLPEYDGFTVCREIRKKSKVPIIM
LTARGEEFDEVFGLDIGADEYISKPFSPNILIARVNAVLRRAVTAAETDTDVKKYNGLIVDHNAHQVTIDGSIVDLSPKE
YELLAYLSENYGKALSREQILDKVWGYDYYGDLRTVDTHINRLRIKLGEKSEFIQTVRGYGYRFEE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
vanRB YP_008394254.1 DNA-binding response regulator VanRB Not tested Not named Protein 3e-33 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Cspa_c27970 YP_007455814.1 Two component transcriptional regulator, winged helix family NC_002952.2859905.p0 Protein 3e-42 46
Cspa_c27970 YP_007455814.1 Two component transcriptional regulator, winged helix family NC_013450.8614421.p0 Protein 3e-42 46
Cspa_c27970 YP_007455814.1 Two component transcriptional regulator, winged helix family NC_007793.3914279.p0 Protein 3e-42 46
Cspa_c27970 YP_007455814.1 Two component transcriptional regulator, winged helix family NC_002745.1124361.p0 Protein 3e-42 46
Cspa_c27970 YP_007455814.1 Two component transcriptional regulator, winged helix family NC_009782.5559369.p0 Protein 3e-42 46
Cspa_c27970 YP_007455814.1 Two component transcriptional regulator, winged helix family NC_002951.3237708.p0 Protein 3e-42 46
Cspa_c27970 YP_007455814.1 Two component transcriptional regulator, winged helix family NC_003923.1003749.p0 Protein 3e-42 46
Cspa_c27970 YP_007455814.1 Two component transcriptional regulator, winged helix family NC_002758.1121668.p0 Protein 3e-42 46
Cspa_c27970 YP_007455814.1 Two component transcriptional regulator, winged helix family NC_007622.3794472.p0 Protein 2e-42 46
Cspa_c27970 YP_007455814.1 Two component transcriptional regulator, winged helix family NC_009641.5332272.p0 Protein 3e-42 46
Cspa_c27970 YP_007455814.1 Two component transcriptional regulator, winged helix family DQ212986.1.gene4.p01 Protein 6e-37 45
Cspa_c27970 YP_007455814.1 Two component transcriptional regulator, winged helix family AE015929.1.gene1106. Protein 6e-32 44
Cspa_c27970 YP_007455814.1 Two component transcriptional regulator, winged helix family AF155139.2.orf0.gene Protein 8e-41 44
Cspa_c27970 YP_007455814.1 Two component transcriptional regulator, winged helix family NC_012469.1.7685629. Protein 3e-41 44
Cspa_c27970 YP_007455814.1 Two component transcriptional regulator, winged helix family HE999704.1.gene2815. Protein 3e-43 44
Cspa_c27970 YP_007455814.1 Two component transcriptional regulator, winged helix family AF253562.2.orf0.gene Protein 6e-25 44
Cspa_c27970 YP_007455814.1 Two component transcriptional regulator, winged helix family NC_012469.1.7686381. Protein 6e-45 43
Cspa_c27970 YP_007455814.1 Two component transcriptional regulator, winged helix family NC_002951.3238224.p0 Protein 2e-33 42
Cspa_c27970 YP_007455814.1 Two component transcriptional regulator, winged helix family NC_007793.3914065.p0 Protein 2e-33 42
Cspa_c27970 YP_007455814.1 Two component transcriptional regulator, winged helix family NC_002758.1121390.p0 Protein 2e-33 42
Cspa_c27970 YP_007455814.1 Two component transcriptional regulator, winged helix family NC_010079.5776364.p0 Protein 2e-33 42
Cspa_c27970 YP_007455814.1 Two component transcriptional regulator, winged helix family NC_002952.2859858.p0 Protein 2e-33 42
Cspa_c27970 YP_007455814.1 Two component transcriptional regulator, winged helix family NC_007622.3794948.p0 Protein 2e-33 42
Cspa_c27970 YP_007455814.1 Two component transcriptional regulator, winged helix family NC_003923.1003417.p0 Protein 2e-33 42
Cspa_c27970 YP_007455814.1 Two component transcriptional regulator, winged helix family NC_013450.8614146.p0 Protein 2e-33 42
Cspa_c27970 YP_007455814.1 Two component transcriptional regulator, winged helix family AF162694.1.orf4.gene Protein 1e-33 42
Cspa_c27970 YP_007455814.1 Two component transcriptional regulator, winged helix family AE016830.1.gene1681. Protein 2e-40 42
Cspa_c27970 YP_007455814.1 Two component transcriptional regulator, winged helix family HE999704.1.gene1528. Protein 4e-31 42
Cspa_c27970 YP_007455814.1 Two component transcriptional regulator, winged helix family CP001918.1.gene3444. Protein 1e-35 42
Cspa_c27970 YP_007455814.1 Two component transcriptional regulator, winged helix family CP000034.1.gene2186. Protein 5e-36 42
Cspa_c27970 YP_007455814.1 Two component transcriptional regulator, winged helix family NC_002695.1.916589.p Protein 4e-36 42
Cspa_c27970 YP_007455814.1 Two component transcriptional regulator, winged helix family BAC0596 Protein 2e-35 42
Cspa_c27970 YP_007455814.1 Two component transcriptional regulator, winged helix family BAC0039 Protein 5e-36 42
Cspa_c27970 YP_007455814.1 Two component transcriptional regulator, winged helix family CP000647.1.gene2531. Protein 3e-36 42
Cspa_c27970 YP_007455814.1 Two component transcriptional regulator, winged helix family CP001138.1.gene2239. Protein 2e-35 42
Cspa_c27970 YP_007455814.1 Two component transcriptional regulator, winged helix family HE999704.1.gene1202. Protein 1e-35 41
Cspa_c27970 YP_007455814.1 Two component transcriptional regulator, winged helix family AF310956.2.orf0.gene Protein 1e-33 41
Cspa_c27970 YP_007455814.1 Two component transcriptional regulator, winged helix family FJ349556.1.orf0.gene Protein 1e-38 41
Cspa_c27970 YP_007455814.1 Two component transcriptional regulator, winged helix family AM180355.1.gene1830. Protein 6e-37 41
Cspa_c27970 YP_007455814.1 Two component transcriptional regulator, winged helix family CP004022.1.gene1676. Protein 6e-33 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Cspa_c27970 YP_007455814.1 Two component transcriptional regulator, winged helix family VFG1386 Protein 8e-31 41