Gene Information

Name : A284_11992 (A284_11992)
Accession : YP_007447254.1
Strain :
Genome accession: NC_020274
Putative virulence/resistance : Unknown
Product : truncated IS431mec-like transposase
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3285 - 3854 bp
Length : 570 bp
Strand : -
Note : COG3316 Transposase and inactivated derivatives

DNA sequence :
TTGAGCTATCGTGATATATCTGAAATATTAAGAGAACGTGGTGTAAACGTTCATCATTCAACGATCTACCGTTGGGTTCA
AGAATATGCCCCAATTTTATATCAAATTTGGAAGAAAAAGCATAAAAAAGCTTATTACAAATGGCGTATTGATGAGACGT
ATATCAAAATAAAAGGAAAATGGAGCTATTTATATCGTGCCATTGATACAGAGGGACATACATTAGATATTTGGTTGCGT
AAGCAACGAGATAATCATTCAGCATATGCGTTTATCAAACGTCTCATTAAACAATTTGGTAAGCCTCAAAAGGTAGTTAC
AGATCAGGCACCTTCAACGAAGGCAGCAATGGCTAAAATAATTAAAGCTTTTAAACTTAAACCTGACTGTCATTGTACAT
CGAAATATCTGAATAACCTCATTGAGCAAGATCACCGTCATATTAAAGTAAGAAAGACAAGATATCAAAGTATCAATACG
GCAAAGAATACTTTAAAAGGTATTGAATGTATTTACGCTCTATATAAAAAGAACCGTAGATCTGAAGAGACCTGCGGTTC
TTTTTATTAA

Protein sequence :
MSYRDISEILRERGVNVHHSTIYRWVQEYAPILYQIWKKKHKKAYYKWRIDETYIKIKGKWSYLYRAIDTEGHTLDIWLR
KQRDNHSAYAFIKRLIKQFGKPQKVVTDQAPSTKAAMAKIIKAFKLKPDCHCTSKYLNNLIEQDHRHIKVRKTRYQSINT
AKNTLKGIECIYALYKKNRRSEETCGSFY

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed AAP55235.1 transposase Not tested SaPIbov2 Protein 9e-66 98
tnp YP_252008.1 transposase for IS431mec Not tested SCCmec Protein 3e-67 97
unnamed ACL99852.1 transposase Not tested Type-V SCCmec Protein 3e-68 96
tnp BAG06195.1 transposase for IS431 Not tested Type-VII SCCmec Protein 3e-68 96
SAPIG0038 YP_005732848.1 transposase Not tested Type-V SCCmec Protein 4e-68 96
unnamed BAB47635.1 putative transposase of IS431 Not tested Type-III SCCmec Protein 1e-67 95
unnamed BAB47648.1 putative transposase of IS431 Not tested Type-III SCCmec Protein 7e-67 95
SAUSA300_0028 YP_492748.1 putative transposase Not tested Type-IV SCCmec Protein 4e-67 95
SAR0027 YP_039504.1 transposase Not tested Type-II SCCmec Protein 4e-67 95
unnamed BAD24828.1 transposase for IS431 Not tested Type-V SCCmec Protein 6e-68 95
tnp BAA86652.1 transposase Not tested Type-I SCCmec Protein 3e-67 95
SERP2526 YP_190067.1 IS431mec-like transposase Not tested Type-II SCCmec Protein 4e-67 95
SAR0034 YP_039511.1 transposase Not tested Type-II SCCmec Protein 4e-67 95
unnamed BAB47631.1 putative transposase of IS431 Not tested Type-III SCCmec Protein 3e-67 95
tnp YP_252002.1 transposase for IS431mec Not tested SCCmec Protein 4e-67 95
SAMSHR1132_00280 YP_005324552.1 putative transposase Not tested Type-IIIinv SCCmec Protein 4e-67 95
tnp BAB72117.1 transposase of IS431mec Not tested Type-IVa SCCmec Protein 3e-67 95
MW0027 NP_644842.1 transposase for IS-like element Not tested Type-IV SCCmec Protein 4e-67 95
SE0079 NP_763634.1 transposase for IS-like element Not tested SCCpbp4 Protein 1e-66 95
tnp BAB72136.1 transposase of IS431mec Not tested Type-IVb SCCmec Protein 3e-67 95
tnp NP_370551.1 transposase for IS-like element Not tested Type-II SCCmec Protein 4e-67 95
SAPIG0054 YP_005732864.1 transposase Not tested Type-V SCCmec Protein 1e-66 95
tnp BAC67570.1 transposase of IS431mec Not tested Type-IVc SCCmec Protein 3e-67 95
tnp NP_370560.2 transposase for IS-like element Not tested Type-II SCCmec Protein 4e-67 95
SE0090 NP_763645.1 transposase for IS-like element Not tested SCCpbp4 Protein 1e-66 95
unnamed BAA82228.1 transposase for insertion sequence-like element IS431mec Not tested Type-II SCCmec Protein 3e-67 95
SA0026 NP_373265.1 transposase for IS-like element Not tested Type-II SCCmec Protein 4e-67 95
unnamed BAA82238.1 transposase for insertion sequence-like element IS431mec Not tested Type-II SCCmec Protein 3e-67 95
unnamed BAB47638.1 putative transposase of IS431 Not tested Type-III SCCmec Protein 7e-67 95
SA0034 NP_373274.1 transposase for IS-like element Not tested Type-II SCCmec Protein 4e-67 95
SACOL0028 YP_184939.1 IS431mec, transposase Not tested Type-I SCCmec Protein 4e-67 95
tnp YP_252034.1 transposase for IS431mec Not tested SCCmec Protein 3e-66 94
SE0071 NP_763626.1 transposase for IS-like element Not tested SCCpbp4 Protein 2e-66 94
tnp BAD24823.1 transposase for IS431 Not tested Type-V SCCmec Protein 1e-66 94
SERP1579 YP_189144.1 IS431mec-like transposase Not tested ¥ÕSP¥â Protein 1e-66 94
tnp YP_251940.1 transposase for IS431mec Not tested SCCmec Protein 3e-65 92
tnp YP_254240.1 transposase for IS431mec Not tested ¥ðSh1 Protein 7e-65 92
ef0041 AAM75240.1 EF0034 Not tested Not named Protein 5e-46 60
ef0039 AAM75245.1 EF0039 Not tested Not named Protein 1e-35 53
tnpA6100 ACN81001.1 transposase Not tested AbaR5 Protein 3e-21 42
tnpA6100 ACN62081.1 TnpA6100 Not tested SGI1 Protein 2e-21 42
tnp6100 ACX47960.1 tnp6100 Not tested SGI1 Protein 5e-22 42
tnpA6100 AGF35032.1 IS6100 transposase Not tested SGI1 Protein 2e-21 42
tnpA6100 AGK07018.1 IS6100 transposase Not tested SGI1 Protein 5e-22 42
tnpA6100 AGF35067.1 IS6100 transposase Not tested SGI1 Protein 2e-21 42
tnpA6100 AGK07076.1 IS6100 transposase Not tested SGI1 Protein 5e-22 42
tnpA6100 AGK06937.1 IS6100 transposase Not tested SGI1 Protein 2e-21 42
tnpA6100 AGK06983.1 IS6100 transposase Not tested SGI1 Protein 2e-21 42
tnpA6100 AGK07042.1 IS6100 transposase Not tested SGI1 Protein 2e-21 42
CDBH8_0916 YP_005160008.1 transposase-like protein Not tested Not named Protein 3e-21 42
tnpA6100 AGK07113.1 IS6100 transposase Not tested SGI1 Protein 2e-21 42
tnpA AAG03007.1 transposase Not tested SGI1 Protein 2e-21 42
tnp6100 ACS32049.1 Tnp6100 Not tested SGI2 Protein 2e-21 42
tnpA6100 AGF34993.1 IS6100 transposase Not tested SGI1 Protein 2e-21 42
tnpA CAJ77056.1 Transposase Not tested AbaR1 Protein 2e-21 42