Gene Information

Name : KSO_018085 (KSO_018085)
Accession : YP_007446981.1
Strain : Bacillus amyloliquefaciens IT-45
Genome accession: NC_020272
Putative virulence/resistance : Resistance
Product : Stress response protein SCP2
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3641743 - 3642339 bp
Length : 597 bp
Strand : -
Note : COG2310 Uncharacterized proteins involved in stress response, homologs of TerZ and putative cAMP-binding protein CABP1

DNA sequence :
ATGGCGATCTCTTTACAAAAAGGACAGCGGATTGATTTAACAAAAGGAAAAGCCGGCCTGTCAAAACTGCTGGTCGGACT
CGGCTGGGACCCTGTATCATCCGGCGGCTTTTTCGGAAAGCTGTTCGGCGGAGGCAGTGCCAATATCGACTGTGACGCTT
CCGTACTGATGCTTGAAAATGATAAAATGACAGACAGCAAAAACGTCATCTATTTCGGCAATCTGAAAAGCCGGTGCGGC
GGTGTCGTACATACGGGTGACAACCTGACGGGTGAAGGCGACGGCGATGATGAACAAATTCTCATCGATTTGGCGAAAGT
GCCCGCTCAGATTAATAAACTTGTGTTTGTCGTCAATATTTACGACTGCGTCAGACGAAAACAGGACTTCGGCATGATTC
AAAACGCGTTCATCCGCGTCGTTGATCAGGCTAATCGCGAAGAACTGGTGACTTACAATTTAAGAGATAACTATTCAGGC
AGAACGAGCCTGATCGCGGCTGAAATCTACCGCGAGGACGGCGAGTGGAAATTCGCCGCGGTGGGAGAAGGCACAAACGA
TACAAAAATCGGCGATATCGTTAACCGATACGCCTAA

Protein sequence :
MAISLQKGQRIDLTKGKAGLSKLLVGLGWDPVSSGGFFGKLFGGGSANIDCDASVLMLENDKMTDSKNVIYFGNLKSRCG
GVVHTGDNLTGEGDGDDEQILIDLAKVPAQINKLVFVVNIYDCVRRKQDFGMIQNAFIRVVDQANREELVTYNLRDNYSG
RTSLIAAEIYREDGEWKFAAVGEGTNDTKIGDIVNRYA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-32 45
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 8e-33 45
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-32 45
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 2e-36 45
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 7e-28 44
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 7e-28 44
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 5e-28 43
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 9e-34 42
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 9e-34 42
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 5e-30 42
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 1e-33 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
KSO_018085 YP_007446981.1 Stress response protein SCP2 BAC0390 Protein 5e-34 45
KSO_018085 YP_007446981.1 Stress response protein SCP2 BAC0392 Protein 7e-28 43
KSO_018085 YP_007446981.1 Stress response protein SCP2 BAC0389 Protein 5e-33 43