Gene Information

Name : KSO_018080 (KSO_018080)
Accession : YP_007446980.1
Strain : Bacillus amyloliquefaciens IT-45
Genome accession: NC_020272
Putative virulence/resistance : Resistance
Product : tellurium resistance protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3641138 - 3641719 bp
Length : 582 bp
Strand : -
Note : COG2310 Uncharacterized proteins involved in stress response, homologs of TerZ and putative cAMP-binding protein CABP1

DNA sequence :
ATGGCAATTTCATTGGCAAAAGGACAAAAAGTAGATTTGACTAAAACAAATCCGGGTCTTTCTAAAGTCGTTGTCGGCCT
TGGCTGGGATACAAACAAATACGATGGCGGACATGATTTTGATTTAGATTCCAGCGTCTTTCTATTAAATGAAGCAGGAA
GATGCGCGTCGCCCGATGATTTTATTTTCTATAATCAGCTTGAAGGCGGAAACGGCTCTGTCGCACATTCAGGCGACAAC
CTTACAGGCCAGGGCGAGGGCGATGACGAAAGTGTAAGGGTCAACCTGAGCGCGGTGCCTGCCGCTATTGACAAAATTTC
ATTCGTCATCACGATTCATGAAGCGGAAGCGCGCGGCCAAAACTTCGGACAAGTTTCCAACGCGTTCGTTCGCATTGTCA
ATGAAGAGACAAATGAAGAGCTGATCCGCTACGATCTGGCTGAAGATTTCTCAATTGAAACAGCCATTATCGCAGGGGAG
CTTTACAGACATAACGGCGAATGGAAATTTTCCGCGATCGGCTCAGGCTATCAAGGCGGACTGGCCCGTATTGCGACAGA
TTACGGCCTGCAAATCGGCTAA

Protein sequence :
MAISLAKGQKVDLTKTNPGLSKVVVGLGWDTNKYDGGHDFDLDSSVFLLNEAGRCASPDDFIFYNQLEGGNGSVAHSGDN
LTGQGEGDDESVRVNLSAVPAAIDKISFVITIHEAEARGQNFGQVSNAFVRIVNEETNEELIRYDLAEDFSIETAIIAGE
LYRHNGEWKFSAIGSGYQGGLARIATDYGLQIG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 1e-55 59
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-55 57
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-55 57
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 2e-55 56
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 4e-47 53
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-46 50
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 3e-46 50
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-46 50
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 7e-31 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
KSO_018080 YP_007446980.1 tellurium resistance protein BAC0389 Protein 1e-55 58
KSO_018080 YP_007446980.1 tellurium resistance protein BAC0390 Protein 6e-51 54