Gene Information

Name : HD73_0642 (HD73_0642)
Accession : YP_007419742.1
Strain : Bacillus cereus HD73
Genome accession: NC_020238
Putative virulence/resistance : Virulence
Product : Two-component response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 647965 - 648636 bp
Length : 672 bp
Strand : +
Note : -

DNA sequence :
ATGCGCTTACTTGTAGTAGAAGATAATGCCTCGTTATTAGAGTCTATCGTACAAATTTTGCGTGATGAATTTGAAGTAGA
TACGGCAATAAATGGAGAAGATGGATTGTTTTTAGCGCTTCAAAATATATATGATGCAATTTTGCTGGATGTGATGATGC
CAGGGATGGATGGATTTGAAGTAATTCAAAAAATACGTGATGAAAAGATTGAAACACCAGTCCTGTTTTTGACAGCGAGA
GATTCTTTAGAAGATCGGGTGAAGGGATTGGATTTTGGTGGAGATGACTATATCGTTAAGCCATTTCAGGCCCCTGAATT
AAAAGCGAGAATTCGCGCTTTACTACGCAGAAGTGGTAGTTTAACAACGCAGCAAACGATTCGTTATAAAGGGATTGAAT
TGTTCGGAAAAGATAAAGACGTTCAAGTAGATGGACAAAGTATTAAGTTGACATTGAAACAATATGAGCTACTAGAGTAT
CTCATTCAAAATAGCGGGAAGATTTTAATGCGTGAACAAATTTTTGATCGTGTTTGGGGATTTGATTCAGATACGACAGT
AGCCATTGTGGAAGTGTATGTGCATCATTTGCGTAAAAAATTAGAACCATTCGGTTATCAGAAAGATATTCAAACTGTTC
GAGGTATTGGATATATATTAAAAGAACAATGA

Protein sequence :
MRLLVVEDNASLLESIVQILRDEFEVDTAINGEDGLFLALQNIYDAILLDVMMPGMDGFEVIQKIRDEKIETPVLFLTAR
DSLEDRVKGLDFGGDDYIVKPFQAPELKARIRALLRRSGSLTTQQTIRYKGIELFGKDKDVQVDGQSIKLTLKQYELLEY
LIQNSGKILMREQIFDRVWGFDSDTTVAIVEVYVHHLRKKLEPFGYQKDIQTVRGIGYILKEQ

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 4e-36 44
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-35 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
HD73_0642 YP_007419742.1 Two-component response regulator BAC0125 Protein 4e-37 46
HD73_0642 YP_007419742.1 Two-component response regulator BAC0638 Protein 3e-35 44
HD73_0642 YP_007419742.1 Two-component response regulator NC_002951.3238224.p0 Protein 2e-41 42
HD73_0642 YP_007419742.1 Two-component response regulator NC_007793.3914065.p0 Protein 2e-41 42
HD73_0642 YP_007419742.1 Two-component response regulator NC_002758.1121390.p0 Protein 2e-41 42
HD73_0642 YP_007419742.1 Two-component response regulator NC_010079.5776364.p0 Protein 2e-41 42
HD73_0642 YP_007419742.1 Two-component response regulator NC_002952.2859858.p0 Protein 2e-41 42
HD73_0642 YP_007419742.1 Two-component response regulator AE015929.1.gene1106. Protein 3e-36 42
HD73_0642 YP_007419742.1 Two-component response regulator NC_007622.3794948.p0 Protein 2e-41 42
HD73_0642 YP_007419742.1 Two-component response regulator NC_003923.1003417.p0 Protein 2e-41 42
HD73_0642 YP_007419742.1 Two-component response regulator NC_013450.8614146.p0 Protein 2e-41 42
HD73_0642 YP_007419742.1 Two-component response regulator BAC0308 Protein 3e-33 42
HD73_0642 YP_007419742.1 Two-component response regulator BAC0083 Protein 1e-40 42
HD73_0642 YP_007419742.1 Two-component response regulator HE999704.1.gene1528. Protein 3e-35 41
HD73_0642 YP_007419742.1 Two-component response regulator BAC0197 Protein 3e-33 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
HD73_0642 YP_007419742.1 Two-component response regulator VFG0596 Protein 1e-36 44
HD73_0642 YP_007419742.1 Two-component response regulator VFG1390 Protein 3e-39 43
HD73_0642 YP_007419742.1 Two-component response regulator VFG1386 Protein 7e-43 43
HD73_0642 YP_007419742.1 Two-component response regulator VFG1389 Protein 3e-37 41