Gene Information

Name : HD73_5163 (HD73_5163)
Accession : YP_007424262.1
Strain : Bacillus cereus HD73
Genome accession: NC_020238
Putative virulence/resistance : Resistance
Product : Two component transcriptional regulator, winged helix
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 4942016 - 4942714 bp
Length : 699 bp
Strand : -
Note : -

DNA sequence :
ATGAAGCGCATTTCAATTTTAATAGTGGATGATGAGGCAGAAATTGCTGATTTAATTGAGATACATTTAGAAAAAGAAGG
GTACCACGTCGTGAAGGCAGCAGACGGGGAAGAGGCTGTTCATATTATTGAAACGCAGCCAATCGACTTAGTGGTTTTAG
ATATTATGATGCCGAAAATGGATGGGTATGAAGTGACGCGTCAAATTCGCGCGAAGCACCATATGCCAATCATTTTCTTA
AGTGCGAAAACGTCTGATTTTGATAAGGTGACAGGTCTTGTATTAGGTGCAGATGATTATATGACGAAACCTTTTACACC
GATTGAATTAGTTGCGCGTGTAAATGCACAATTACGTAGGTTTCTTACATTAAATCAGCCGAAAGTAGCGGGGAATAAAT
CTGCTTTAGAGGTAGGCGGAGTTATTATTGATCCTGAGCAAAGAACAGTGAACGTCTATGGAGAGCAAATTGAGTTAACG
CCGAAAGAGTTTGATATTTTATATTTATTAGCGAGCCATCCGAAGAAAGTGTATAATGTGGAAAATATTTTTCAGCAAGT
ATGGGCAGATGATTATTATGAAGGCGGAAATACAGTTATGGTACATATTCGTACGTTGCGGAAAAAGCTTGGGGAAGATA
AAAGAAAAGATAAGCTAATAAAAACAGTGTGGGGAGTAGGGTATACTTTCAATGGCTAA

Protein sequence :
MKRISILIVDDEAEIADLIEIHLEKEGYHVVKAADGEEAVHIIETQPIDLVVLDIMMPKMDGYEVTRQIRAKHHMPIIFL
SAKTSDFDKVTGLVLGADDYMTKPFTPIELVARVNAQLRRFLTLNQPKVAGNKSALEVGGVIIDPEQRTVNVYGEQIELT
PKEFDILYLLASHPKKVYNVENIFQQVWADDYYEGGNTVMVHIRTLRKKLGEDKRKDKLIKTVWGVGYTFNG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
nisR2 YP_006309922.1 NisR Not tested FWisland_1 Protein 3e-25 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
HD73_5163 YP_007424262.1 Two component transcriptional regulator, winged helix FJ349556.1.orf0.gene Protein 3e-91 78
HD73_5163 YP_007424262.1 Two component transcriptional regulator, winged helix AF155139.2.orf0.gene Protein 2e-90 76
HD73_5163 YP_007424262.1 Two component transcriptional regulator, winged helix AF162694.1.orf4.gene Protein 2e-50 49
HD73_5163 YP_007424262.1 Two component transcriptional regulator, winged helix AM180355.1.gene1830. Protein 6e-51 48
HD73_5163 YP_007424262.1 Two component transcriptional regulator, winged helix AF130997.1.orf0.gene Protein 1e-49 46
HD73_5163 YP_007424262.1 Two component transcriptional regulator, winged helix NC_014475.1.orf0.gen Protein 2e-46 45
HD73_5163 YP_007424262.1 Two component transcriptional regulator, winged helix NC_005054.2598277.p0 Protein 2e-46 45
HD73_5163 YP_007424262.1 Two component transcriptional regulator, winged helix DQ212986.1.gene4.p01 Protein 7e-51 45
HD73_5163 YP_007424262.1 Two component transcriptional regulator, winged helix AE015929.1.gene1106. Protein 5e-34 44
HD73_5163 YP_007424262.1 Two component transcriptional regulator, winged helix NC_012469.1.7685629. Protein 7e-44 44
HD73_5163 YP_007424262.1 Two component transcriptional regulator, winged helix EU250284.1.orf4.gene Protein 3e-45 44
HD73_5163 YP_007424262.1 Two component transcriptional regulator, winged helix NC_002952.2859858.p0 Protein 1e-36 43
HD73_5163 YP_007424262.1 Two component transcriptional regulator, winged helix NC_007622.3794948.p0 Protein 1e-36 43
HD73_5163 YP_007424262.1 Two component transcriptional regulator, winged helix NC_003923.1003417.p0 Protein 1e-36 43
HD73_5163 YP_007424262.1 Two component transcriptional regulator, winged helix NC_013450.8614146.p0 Protein 1e-36 43
HD73_5163 YP_007424262.1 Two component transcriptional regulator, winged helix NC_002951.3238224.p0 Protein 1e-36 43
HD73_5163 YP_007424262.1 Two component transcriptional regulator, winged helix NC_007793.3914065.p0 Protein 1e-36 43
HD73_5163 YP_007424262.1 Two component transcriptional regulator, winged helix NC_002758.1121390.p0 Protein 1e-36 43
HD73_5163 YP_007424262.1 Two component transcriptional regulator, winged helix NC_010079.5776364.p0 Protein 1e-36 43
HD73_5163 YP_007424262.1 Two component transcriptional regulator, winged helix NC_002952.2859905.p0 Protein 4e-42 43
HD73_5163 YP_007424262.1 Two component transcriptional regulator, winged helix NC_002758.1121668.p0 Protein 3e-42 43
HD73_5163 YP_007424262.1 Two component transcriptional regulator, winged helix NC_003923.1003749.p0 Protein 3e-42 43
HD73_5163 YP_007424262.1 Two component transcriptional regulator, winged helix NC_009782.5559369.p0 Protein 3e-42 43
HD73_5163 YP_007424262.1 Two component transcriptional regulator, winged helix NC_002951.3237708.p0 Protein 3e-42 43
HD73_5163 YP_007424262.1 Two component transcriptional regulator, winged helix NC_007622.3794472.p0 Protein 4e-42 43
HD73_5163 YP_007424262.1 Two component transcriptional regulator, winged helix NC_002745.1124361.p0 Protein 3e-42 43
HD73_5163 YP_007424262.1 Two component transcriptional regulator, winged helix NC_009641.5332272.p0 Protein 3e-42 43
HD73_5163 YP_007424262.1 Two component transcriptional regulator, winged helix NC_013450.8614421.p0 Protein 3e-42 43
HD73_5163 YP_007424262.1 Two component transcriptional regulator, winged helix NC_007793.3914279.p0 Protein 3e-42 43
HD73_5163 YP_007424262.1 Two component transcriptional regulator, winged helix CP004022.1.gene3215. Protein 4e-36 42
HD73_5163 YP_007424262.1 Two component transcriptional regulator, winged helix HE999704.1.gene2815. Protein 4e-40 41
HD73_5163 YP_007424262.1 Two component transcriptional regulator, winged helix AE000516.2.gene3505. Protein 6e-31 41