Gene Information

Name : basR (SMWW4_v1c04200)
Accession : YP_007404246.1
Strain : Serratia marcescens WW4
Genome accession: NC_020211
Putative virulence/resistance : Virulence
Product : DNA-binding response regulator in two-component regulatory system with BasS
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 476747 - 477409 bp
Length : 663 bp
Strand : -
Note : -

DNA sequence :
ATGAAGCTGCTGGTCGTTGAAGATGATGAACTGCTGCAACAAGGGCTGGCGCTGGCGCTGACCGGTGAAGGCTACGTGTG
CGACTGCGCCGCCACAGCGGCGGAGGCCAGCAGCCTGCTCATCACCAGCCAATACAGCATGGTGATCCTGGATCTCGGCC
TGCCGGACATGGACGGCGCAGCGCTGCTGCGGCAGTGGCGCCGCCAGCAGATCGATCTGCCGGTGCTGATCCTGACCGCC
CGCGACGCCCTGGAAGACCGCGTCGATGGGCTGGACGCCGGCGCCGACGACTACCTGGTCAAACCCTTCGCGCTGGTTGA
GCTGCAGGCGCGCGTGCGCGCTCTCCTGCGGCGCTACCAGGGCCACAGCGACAATCTGATGCAGGTGGATGACCTGCAGT
TGAATCTCTCCAGCCAGCAGGTCTATCTGCAACAGCAGCCGGTGGAGGTCACGCCGAAAGAGTTCGCCATTCTGGCGCGC
CTGATCATGCGTGCCGGGCAGACGGTCAACCGCGAACTCCTGCAGCAGGATCTCTACACCTGGCAAGATGATTTAGGTTC
CAACACCCTGGAAGTGCATATTCACAACCTGCGCCGCAAACTGGGCAAGGATCGCATTCGCACCGTGCGCGGCATCGGCT
ACCGCCTGGAACCCTCGTCATGA

Protein sequence :
MKLLVVEDDELLQQGLALALTGEGYVCDCAATAAEASSLLITSQYSMVILDLGLPDMDGAALLRQWRRQQIDLPVLILTA
RDALEDRVDGLDAGADDYLVKPFALVELQARVRALLRRYQGHSDNLMQVDDLQLNLSSQQVYLQQQPVEVTPKEFAILAR
LIMRAGQTVNRELLQQDLYTWQDDLGSNTLEVHIHNLRRKLGKDRIRTVRGIGYRLEPSS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
armR AAN62112.1 putative response-regulator ArmR Not tested PAGI-2(C) Protein 1e-35 49
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 4e-27 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 3e-26 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
basR YP_007404246.1 DNA-binding response regulator in two-component regulatory system with BasS BAC0487 Protein 4e-62 67
basR YP_007404246.1 DNA-binding response regulator in two-component regulatory system with BasS BAC0197 Protein 7e-27 43
basR YP_007404246.1 DNA-binding response regulator in two-component regulatory system with BasS NC_002516.2.879194.p Protein 6e-30 42
basR YP_007404246.1 DNA-binding response regulator in two-component regulatory system with BasS CP000647.1.gene1136. Protein 2e-29 42
basR YP_007404246.1 DNA-binding response regulator in two-component regulatory system with BasS BAC0530 Protein 2e-29 42
basR YP_007404246.1 DNA-binding response regulator in two-component regulatory system with BasS CP001918.1.gene2526. Protein 2e-28 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
basR YP_007404246.1 DNA-binding response regulator in two-component regulatory system with BasS VFG0473 Protein 1e-50 56
basR YP_007404246.1 DNA-binding response regulator in two-component regulatory system with BasS VFG0596 Protein 2e-27 42