Gene Information

Name : SMWW4_v1c24910 (SMWW4_v1c24910)
Accession : YP_007406307.1
Strain : Serratia marcescens WW4
Genome accession: NC_020211
Putative virulence/resistance : Resistance
Product : major facilitator superfamily transporter
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2701399 - 2702565 bp
Length : 1167 bp
Strand : +
Note : -

DNA sequence :
ATGCTGGTTATTTTGTTGACGGTGTTGCTGGATGCGGTGGGCATCGGTCTGATCATGCCGATCCTGCCGGTGCTGTTGCG
CTCGCTGGGCGGTCTTGACGCCGGCAGCCTGCATTACGGTGCCCTGCTGGCGGCCTATGCGCTGATGCAATTCCTGTTTT
CACCGATCCTCGGCGCGTTGAGCGATCGCTTCGGCCGGCGGCCGGTGCTGTTAATTTCACTCGCCGGCGCCGCGGCCGAC
TACCTGCTGATGGCGTTCGCGCCGACGCTGGCCTGGCTCTATCTGGGCCGGTTGCTGGCGGGCATCACCGGCGCCAACAT
GGCGGTCGCCACCGCTTACGTTACCGATATTACTCCTGCCGGCCAGCGCGCGCGGCGTTTCGGCCTGGTGGGCGCGGTGT
TCGGCGTCGGCTTTATCGTCGGCCCGCTGCTCGGCGGTTCGCTGGGCGAGTGGCATCTGCATGCGCCCTTCCTGGCGGCG
GCGGCGATGAATGCCCTCAACCTGGCGATGGCGTTTTTCCTGCTGCCGGAATCGCGTAAACCCCGCACCCGCGCCGCCGA
GAAAATCCGCCTCAATCCCTTTTCGTCATTGCGACGGCTGCACGGCAAACCGGGCCTGCTGCCGCTGGCCGGCATTTATC
TGATCATGGCGCTGGTTTCACAGGCGCCGGCCACGCTGTGGATTTTATACGGCCAGGATCGTTTCGGCTGGAGCATGATG
GTGGCGGGCCTGTCGCTGGCCGGTTACGGTGCCTGCCACGCGCTGTCGCAGGCCTTCGCCATCGGCCCGCTGGTCGCGCG
GCTCGGCGAACGCAAGGCGCTGCTGATCGGCCTGACCGCCGACGCGCTGGGCCTGGTGCTGTTATCGATCGCCACGCGCG
GCTGGGCGCCCTTTGCGCTGCTGCCGTTCTTCGCCGCGGGCGGTATGGCGCTGCCCGCGCTGCAGGCGTTAATGGCGCAC
AAAGTGGACGACGATCATCAGGGCGAGCTGCAAGGGACGCTGGCCAGCATGGGCAGCCTGATCGGCGTCGCGGGGCCGCT
GATGGCGACGGCGCTGTATGCCGCCACGCGTGATGTCTGGCCCGGCCTGGTCTGGGCGTTGGCCGCCGCCCTCTATCTGC
TGGTGCCGCCGTTGCTGGCGCGTTCGCGCGAGCGTGACGCGGCATAG

Protein sequence :
MLVILLTVLLDAVGIGLIMPILPVLLRSLGGLDAGSLHYGALLAAYALMQFLFSPILGALSDRFGRRPVLLISLAGAAAD
YLLMAFAPTLAWLYLGRLLAGITGANMAVATAYVTDITPAGQRARRFGLVGAVFGVGFIVGPLLGGSLGEWHLHAPFLAA
AAMNALNLAMAFFLLPESRKPRTRAAEKIRLNPFSSLRRLHGKPGLLPLAGIYLIMALVSQAPATLWILYGQDRFGWSMM
VAGLSLAGYGACHALSQAFAIGPLVARLGERKALLIGLTADALGLVLLSIATRGWAPFALLPFFAAGGMALPALQALMAH
KVDDDHQGELQGTLASMGSLIGVAGPLMATALYAATRDVWPGLVWALAAALYLLVPPLLARSRERDAA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
tetA(A) ACK44537.1 TetA(A) Not tested SGI1 Protein 2e-62 55
tetA(A) AGK07027.1 TetA(A) Not tested SGI1 Protein 2e-62 55
tetA(A) AGK07085.1 TetA(A) Not tested SGI1 Protein 2e-62 55
tetA YP_006098396.1 tetracycline resistance protein Not tested Tn2411 Protein 2e-62 55
tetA CAJ77066.1 Tetracycline resistance protein Not tested AbaR1 Protein 2e-62 55
tetA(A) ACN81011.1 TetA(A) Not tested AbaR5 Protein 2e-62 55
tet(G) AAK02051.1 tetracycline resistance protein Not tested SGI1 Protein 4e-57 52
tetA(G) ABZ01843.1 TetA(G) Not tested SGI2 Protein 4e-57 52
tetA(G) AGK06974.1 TetA(G) Not tested SGI1 Protein 4e-57 52
tetA(G) AGK07104.1 TetA(G) Not tested SGI1 Protein 4e-57 52
tetA CAJ77034.1 Tetracycline resistance protein Not tested AbaR1 Protein 2e-59 52
tetA YP_005797160.1 tetracycline resistance protein, class G (TETA(G)) Not tested AbaR4e Protein 8e-46 45
tetA(B) AAL08445.1 tetracycline resistance protein TetA(B) Not tested SRL Protein 3e-46 45
tetB AEA34667.1 tetracycline resistance determinant Not tested Not named Protein 2e-46 45
tetA(B) AEZ06045.1 tetracycline efflux protein Not tested Tn6167 Protein 3e-46 45
BJAB07104_00277 YP_008207742.1 Permeases of the major facilitator superfamily Not tested AbaR25 Protein 3e-46 45
BJAB0868_00281 YP_008211607.1 Permeases of the major facilitator superfamily Not tested AbaR26 Protein 3e-46 45
tetA(B) AEQ20905.1 tetracycline resistance protein Not tested Tn6166 Protein 3e-46 45
ABZJ_00260 YP_005524216.1 Tetracycline resistance protein, class B (TETA(B) ) (Metal-tetracycline/H(+) antiporter) Not tested AbaR22 Protein 3e-46 45
tetA(B) AFH57202.1 tetracycline resistance protein Not tested AbaR4a Protein 3e-46 45
tet(H) YP_005176248.1 tetracycline efflux protein, class H Not tested ICEPmu1 Protein 2e-41 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SMWW4_v1c24910 YP_007406307.1 major facilitator superfamily transporter AY264780.2.gene3.p01 Protein 5e-118 97
SMWW4_v1c24910 YP_007406307.1 major facilitator superfamily transporter AY743590.gene.p01 Protein 2e-77 64
SMWW4_v1c24910 YP_007406307.1 major facilitator superfamily transporter Y19114.gene.p01 Protein 5e-62 56
SMWW4_v1c24910 YP_007406307.1 major facilitator superfamily transporter AF534183.gene.p01 Protein 1e-62 55
SMWW4_v1c24910 YP_007406307.1 major facilitator superfamily transporter NC_010410.6002597.p0 Protein 1e-62 55
SMWW4_v1c24910 YP_007406307.1 major facilitator superfamily transporter CP001485.1.gene2821. Protein 1e-62 55
SMWW4_v1c24910 YP_007406307.1 major facilitator superfamily transporter AF090987.gene.p01 Protein 8e-57 54
SMWW4_v1c24910 YP_007406307.1 major facilitator superfamily transporter NC_011586.7045189.p0 Protein 4e-57 54
SMWW4_v1c24910 YP_007406307.1 major facilitator superfamily transporter X75761.gene.p01 Protein 4e-62 54
SMWW4_v1c24910 YP_007406307.1 major facilitator superfamily transporter NC_010410.6002612.p0 Protein 1e-59 52
SMWW4_v1c24910 YP_007406307.1 major facilitator superfamily transporter AF133140.gene.p01 Protein 1e-59 52
SMWW4_v1c24910 YP_007406307.1 major facilitator superfamily transporter AF133139.gene.p01 Protein 1e-57 51
SMWW4_v1c24910 YP_007406307.1 major facilitator superfamily transporter NC_011595.7059241.p0 Protein 5e-44 46
SMWW4_v1c24910 YP_007406307.1 major facilitator superfamily transporter NC_011586.7043399.p0 Protein 6e-44 46
SMWW4_v1c24910 YP_007406307.1 major facilitator superfamily transporter NC_010410.6003291.p0 Protein 6e-44 46
SMWW4_v1c24910 YP_007406307.1 major facilitator superfamily transporter AJ420072.gene.p01 Protein 2e-44 46
SMWW4_v1c24910 YP_007406307.1 major facilitator superfamily transporter NC_009085.4918440.p0 Protein 1e-44 46
SMWW4_v1c24910 YP_007406307.1 major facilitator superfamily transporter Y19116.gene.p01 Protein 1e-45 45
SMWW4_v1c24910 YP_007406307.1 major facilitator superfamily transporter AF038993.gene.p01 Protein 2e-42 45
SMWW4_v1c24910 YP_007406307.1 major facilitator superfamily transporter NC_010558.1.6275971. Protein 2e-46 45
SMWW4_v1c24910 YP_007406307.1 major facilitator superfamily transporter V00611.gene.p01 Protein 6e-46 45
SMWW4_v1c24910 YP_007406307.1 major facilitator superfamily transporter AB084246.gene.p01 Protein 1e-46 45
SMWW4_v1c24910 YP_007406307.1 major facilitator superfamily transporter L06940.gene.p01 Protein 2e-45 45
SMWW4_v1c24910 YP_007406307.1 major facilitator superfamily transporter Y15510.gene.p01 Protein 3e-42 45
SMWW4_v1c24910 YP_007406307.1 major facilitator superfamily transporter AF121000.gene.p01 Protein 2e-44 44
SMWW4_v1c24910 YP_007406307.1 major facilitator superfamily transporter CP004022.1.gene2534. Protein 3e-42 44
SMWW4_v1c24910 YP_007406307.1 major facilitator superfamily transporter L06798.gene.p01 Protein 5e-36 44
SMWW4_v1c24910 YP_007406307.1 major facilitator superfamily transporter AJ250203.gene.p01 Protein 3e-39 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SMWW4_v1c24910 YP_007406307.1 major facilitator superfamily transporter VFG1036 Protein 1e-46 45