Gene Information

Name : SMWW4_v1c18910 (SMWW4_v1c18910)
Accession : YP_007405711.1
Strain : Serratia marcescens WW4
Genome accession: NC_020211
Putative virulence/resistance : Resistance
Product : AraC family transcriptional regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2076854 - 2077210 bp
Length : 357 bp
Strand : +
Note : -

DNA sequence :
ATGAACACTACGGGCTTTATTACCGATTTGAAGGCGTGGATCGACAACAATCTGGAAGAGAAACTGGATATCAACACCGT
GGCGGACCGCGCGGGCTATTCCAAATGGCATCTGCAGCGCATGTTCAAACGCCAGACCGGCTACGCGCTGGGGGAGTATA
TCCGCATGCAAAAACTGAAAGTGTCGGCGGAGCGCCTGGCCAACAGCGGCGAGCCTATCGTCAGCGTGGCGATCTCGCTC
GGCTTCGACTCACAGCAGTCGTTCAACCGCAGCTTCAAACGCCAATTCGGCCAAACGCCGGGCGATTGGCGCCGCGCGCT
GGCGCAGCCGGCGTCAATGGGGCGCACGCACCACTGA

Protein sequence :
MNTTGFITDLKAWIDNNLEEKLDINTVADRAGYSKWHLQRMFKRQTGYALGEYIRMQKLKVSAERLANSGEPIVSVAISL
GFDSQQSFNRSFKRQFGQTPGDWRRALAQPASMGRTHH

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
soxS YP_219131.1 DNA-binding transcriptional regulator SoxS Not tested SPI-4 Protein 2e-22 45
tetD AAL08447.1 putative transcriptional regulator TetD Not tested SRL Protein 9e-18 44
tetD AEA34665.1 tetracycline resistance protein D Not tested Not named Protein 9e-18 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SMWW4_v1c18910 YP_007405711.1 AraC family transcriptional regulator CP000647.1.gene1624. Protein 1e-22 49
SMWW4_v1c18910 YP_007405711.1 AraC family transcriptional regulator CP001918.1.gene2033. Protein 1e-22 49
SMWW4_v1c18910 YP_007405711.1 AraC family transcriptional regulator CP001138.1.gene1637. Protein 2e-22 48
SMWW4_v1c18910 YP_007405711.1 AraC family transcriptional regulator BAC0371 Protein 2e-23 47
SMWW4_v1c18910 YP_007405711.1 AraC family transcriptional regulator NC_002695.1.914293.p Protein 2e-23 47
SMWW4_v1c18910 YP_007405711.1 AraC family transcriptional regulator BAC0560 Protein 2e-22 47
SMWW4_v1c18910 YP_007405711.1 AraC family transcriptional regulator NC_002695.1.917339.p Protein 2e-22 47
SMWW4_v1c18910 YP_007405711.1 AraC family transcriptional regulator CP000034.1.gene1596. Protein 2e-22 47
SMWW4_v1c18910 YP_007405711.1 AraC family transcriptional regulator CP000034.1.gene4505. Protein 4e-23 46
SMWW4_v1c18910 YP_007405711.1 AraC family transcriptional regulator CP001138.1.gene4488. Protein 8e-23 45
SMWW4_v1c18910 YP_007405711.1 AraC family transcriptional regulator CP001918.1.gene327.p Protein 5e-23 44
SMWW4_v1c18910 YP_007405711.1 AraC family transcriptional regulator CP001138.1.gene612.p Protein 4e-20 44
SMWW4_v1c18910 YP_007405711.1 AraC family transcriptional regulator NC_010558.1.6276025. Protein 4e-18 44
SMWW4_v1c18910 YP_007405711.1 AraC family transcriptional regulator CP000647.1.gene4499. Protein 8e-23 43

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SMWW4_v1c18910 YP_007405711.1 AraC family transcriptional regulator VFG0585 Protein 7e-23 45
SMWW4_v1c18910 YP_007405711.1 AraC family transcriptional regulator VFG1038 Protein 4e-18 44