Gene Information

Name : SMWW4_v1c14840 (SMWW4_v1c14840)
Accession : YP_007405307.1
Strain : Serratia marcescens WW4
Genome accession: NC_020211
Putative virulence/resistance : Virulence
Product : two component heavy metal response transcriptional regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1621127 - 1621798 bp
Length : 672 bp
Strand : +
Note : -

DNA sequence : 
ATGCGAATACTGGTAGTTGAAGACGATATCGGCACAGGGGATTACCTGAAGAAAGGGCTGGGGGAAGCGGGCTACGGCGT
CGATTTGGCGCGCACCGGCACCGACGGGCTGTTTCGCGCGTTGGAGCAGGACTACGATGCGATCGTGCTCGACGTGATGC
TGCCGGGGCTGGACGGCTGGCAGATCATCGAGGTGTTGCGCAAGAAAAGCGACGTGCCGATCCTGTTTCTCACCGCCCGC
GACGGCGTACAGGATCGCATCCACGGTCTGGAGCTGGGCGCGGACGACTATCTTATCAAACCCTTTTCCTTTACCGAGCT
GGTGCTGCGTTTGCGCACCTTGCTGCGCCGCGGGCCGGCGCGCGAAGCCGATCATTACGCCATCGCCGATCTGCAGTTGG
ACGTGCTGCGCCGCCGGGCGGTGCGCCAGGATCAGGTGATCCCGTTGACCAACAAGGAGTTCATGCTGCTGCATCTGCTG
GTGCGGCGCGAAGGCGAAGTGCTGTCGCGCACGCAGATCGCCTCCCAGGTGTGGGACATGAATTTCGACAGCGACACTAA
TGTGGTTGATGTGGCGATCAAACGCCTGCGCGCCAAAATCGACCGGCCGTTCGACGTCAAGCTGATCCACAGCGTGCGCG
GCATCGGCTATGTTTGCGAGCCGCGCCCGTGA

Protein sequence : 
MRILVVEDDIGTGDYLKKGLGEAGYGVDLARTGTDGLFRALEQDYDAIVLDVMLPGLDGWQIIEVLRKKSDVPILFLTAR
DGVQDRIHGLELGADDYLIKPFSFTELVLRLRTLLRRGPAREADHYAIADLQLDVLRRRAVRQDQVIPLTNKEFMLLHLL
VRREGEVLSRTQIASQVWDMNFDSDTNVVDVAIKRLRAKIDRPFDVKLIHSVRGIGYVCEPRP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-50 53
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 7e-50 53

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SMWW4_v1c14840 YP_007405307.1 two component heavy metal response transcriptional regulator BAC0125 Protein 1e-62 63
SMWW4_v1c14840 YP_007405307.1 two component heavy metal response transcriptional regulator BAC0197 Protein 2e-61 63
SMWW4_v1c14840 YP_007405307.1 two component heavy metal response transcriptional regulator BAC0083 Protein 1e-57 62
SMWW4_v1c14840 YP_007405307.1 two component heavy metal response transcriptional regulator BAC0308 Protein 3e-55 60
SMWW4_v1c14840 YP_007405307.1 two component heavy metal response transcriptional regulator BAC0638 Protein 5e-50 59
SMWW4_v1c14840 YP_007405307.1 two component heavy metal response transcriptional regulator BAC0111 Protein 3e-54 56
SMWW4_v1c14840 YP_007405307.1 two component heavy metal response transcriptional regulator BAC0347 Protein 1e-46 51
SMWW4_v1c14840 YP_007405307.1 two component heavy metal response transcriptional regulator AE000516.2.gene3505. Protein 4e-29 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SMWW4_v1c14840 YP_007405307.1 two component heavy metal response transcriptional regulator VFG0596 Protein 7e-51 53
SMWW4_v1c14840 YP_007405307.1 two component heavy metal response transcriptional regulator VFG1390 Protein 8e-34 45
SMWW4_v1c14840 YP_007405307.1 two component heavy metal response transcriptional regulator VFG1386 Protein 7e-30 43
SMWW4_v1c14840 YP_007405307.1 two component heavy metal response transcriptional regulator VFG1389 Protein 3e-29 42