Gene Information

Name : resD (GHH_c23670)
Accession : YP_007402629.1
Strain : Geobacillus sp. GHH01
Genome accession: NC_020210
Putative virulence/resistance : Virulence
Product : transcriptional regulatory protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2372939 - 2373664 bp
Length : 726 bp
Strand : -
Note : -

DNA sequence :
TTGGAAAAACAAGAAAAAACCATCCGTATTTTAGTGGTTGACGATGAAGAGCGCATCCGGCGGCTCTTGAAAATGTATTT
GGAGCGGGAAAACTATGTGATCGATGAGGCCGGCGACGGCAATGAAGCGTTGGAGAAGGCGTTGACGAATGATTATGACG
TCATTTTGCTCGATCTGATGCTGCCGGGCAAAGATGGAATTGAGGTGTGCAAAGAAATCCGCGAGCAAAAAACGACGCCG
ATCATCATGTTGACGGCAAAAGGCGAAGAATCCAACCGCGTGCAAGGGTTTGAAGTCGGCACGGATGATTACATCGTCAA
GCCGTTCAGTCCGCGCGAAGTCGTGCTGCGCGTAAAAGCGCTGTTGCGCCGCGCGGCGAACGCCGCCTACGCGCCGGTGG
AGACGACGGCGAAAGACGTGCTTGTGTTTCCGCATTTGACGATTGACAACGATGCCCACCGGGTGACGGTCGACGGCAAG
GAAGTCAGCTTAACGCCGAAAGAATATGAGCTGCTTCTCTTTTTGGCCCGCTCGCCCGACAAAGTGTTCGACCGCGAACA
GCTGTTGAAGGAAGTATGGCATTACGAGTTTTTCGGCGACTTGCGCACGGTCGACACCCACATTAAACGGTTGCGCGAAA
AGTTGAATAAAGCGTCGCCGCAGGCGGGAAAAATGATCGTCACCGTCTGGGGCGTCGGCTACAAGTTTGAGGCAGTGAGC
GACTAA

Protein sequence :
MEKQEKTIRILVVDDEERIRRLLKMYLERENYVIDEAGDGNEALEKALTNDYDVILLDLMLPGKDGIEVCKEIREQKTTP
IIMLTAKGEESNRVQGFEVGTDDYIVKPFSPREVVLRVKALLRRAANAAYAPVETTAKDVLVFPHLTIDNDAHRVTVDGK
EVSLTPKEYELLLFLARSPDKVFDREQLLKEVWHYEFFGDLRTVDTHIKRLREKLNKASPQAGKMIVTVWGVGYKFEAVS
D

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 3e-34 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
resD YP_007402629.1 transcriptional regulatory protein NC_002952.2859905.p0 Protein 8e-40 50
resD YP_007402629.1 transcriptional regulatory protein NC_009641.5332272.p0 Protein 6e-40 50
resD YP_007402629.1 transcriptional regulatory protein NC_013450.8614421.p0 Protein 6e-40 50
resD YP_007402629.1 transcriptional regulatory protein NC_007793.3914279.p0 Protein 6e-40 50
resD YP_007402629.1 transcriptional regulatory protein NC_002745.1124361.p0 Protein 6e-40 50
resD YP_007402629.1 transcriptional regulatory protein NC_009782.5559369.p0 Protein 6e-40 50
resD YP_007402629.1 transcriptional regulatory protein NC_002951.3237708.p0 Protein 6e-40 50
resD YP_007402629.1 transcriptional regulatory protein NC_007622.3794472.p0 Protein 8e-40 50
resD YP_007402629.1 transcriptional regulatory protein NC_003923.1003749.p0 Protein 5e-40 50
resD YP_007402629.1 transcriptional regulatory protein NC_002758.1121668.p0 Protein 6e-40 50
resD YP_007402629.1 transcriptional regulatory protein NC_002951.3238224.p0 Protein 1e-38 45
resD YP_007402629.1 transcriptional regulatory protein NC_007793.3914065.p0 Protein 1e-38 45
resD YP_007402629.1 transcriptional regulatory protein NC_002758.1121390.p0 Protein 1e-38 45
resD YP_007402629.1 transcriptional regulatory protein NC_010079.5776364.p0 Protein 1e-38 45
resD YP_007402629.1 transcriptional regulatory protein NC_002952.2859858.p0 Protein 1e-38 45
resD YP_007402629.1 transcriptional regulatory protein NC_007622.3794948.p0 Protein 1e-38 45
resD YP_007402629.1 transcriptional regulatory protein NC_003923.1003417.p0 Protein 1e-38 45
resD YP_007402629.1 transcriptional regulatory protein NC_013450.8614146.p0 Protein 1e-38 45
resD YP_007402629.1 transcriptional regulatory protein AE016830.1.gene1681. Protein 2e-43 45
resD YP_007402629.1 transcriptional regulatory protein HE999704.1.gene2815. Protein 2e-40 45
resD YP_007402629.1 transcriptional regulatory protein NC_012469.1.7685629. Protein 5e-36 45
resD YP_007402629.1 transcriptional regulatory protein AE000516.2.gene3505. Protein 1e-41 45
resD YP_007402629.1 transcriptional regulatory protein AE015929.1.gene1106. Protein 3e-33 44
resD YP_007402629.1 transcriptional regulatory protein NC_002695.1.916589.p Protein 8e-32 44
resD YP_007402629.1 transcriptional regulatory protein HE999704.1.gene1528. Protein 2e-34 43
resD YP_007402629.1 transcriptional regulatory protein NC_012469.1.7686381. Protein 5e-38 43
resD YP_007402629.1 transcriptional regulatory protein BAC0596 Protein 6e-31 43
resD YP_007402629.1 transcriptional regulatory protein CP000034.1.gene2186. Protein 9e-32 43
resD YP_007402629.1 transcriptional regulatory protein CP001138.1.gene2239. Protein 6e-31 43
resD YP_007402629.1 transcriptional regulatory protein CP001918.1.gene3444. Protein 4e-31 43
resD YP_007402629.1 transcriptional regulatory protein BAC0039 Protein 9e-32 43
resD YP_007402629.1 transcriptional regulatory protein AM180355.1.gene1830. Protein 2e-32 42
resD YP_007402629.1 transcriptional regulatory protein CP000647.1.gene2531. Protein 8e-30 42
resD YP_007402629.1 transcriptional regulatory protein CP004022.1.gene1676. Protein 8e-33 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
resD YP_007402629.1 transcriptional regulatory protein VFG1563 Protein 2e-34 41