Gene Information

Name : H045_23295 (H045_23295)
Accession : YP_007400213.1
Strain : Pseudomonas poae RE*1-1-14
Genome accession: NC_020209
Putative virulence/resistance : Resistance
Product : SMR family multidrug resistance protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 5322964 - 5323299 bp
Length : 336 bp
Strand : -
Note : COG2076 Membrane transporters of cations and cationic drugs

DNA sequence :
ATGAATCCCGCCTATTACTACCTGGCTATCGCCATCTGCTCGGAAGTGATCGCCACCGTGTCCATGAAAGCCATCAAGGG
CTGGAGTACGCCGATCCCGCTGCTGCTGGTGATCGTGGGGTATGGCGTGGCGTTCTGGATGCTCACCCTGGTGGTGCGCA
CGGTGCCGGTGGGCGTGGCGTATGCCGTGTGGGCCGGAATGGGCATTGTGATGGTGAGCATCGCCGCGTTGTTTATCTAC
GGGCAGAAGCTCGATGTGCCGGCGATGCTGGGGATGGGCTTGATTGTGCTGGGCGTGGTGGTGATCCAGCTGTTCTCGAA
AACCGCCGGGCACTGA

Protein sequence :
MNPAYYYLAIAICSEVIATVSMKAIKGWSTPIPLLLVIVGYGVAFWMLTLVVRTVPVGVAYAVWAGMGIVMVSIAALFIY
GQKLDVPAMLGMGLIVLGVVVIQLFSKTAGH

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
qacEdelta1 AGK07109.1 QacEdelta1 Not tested SGI1 Protein 9e-13 49
qacEdelta1 AGF35028.1 QacEdelta1 Not tested SGI1 Protein 9e-13 49
qacEdelta1 CAJ77052.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 9e-13 49
qacEdelta1 ACN81026.1 QacEdelta1 Not tested AbaR5 Protein 1e-12 49
qacEdelta1 AFV53123.1 QacEdelta1 multidrug exporter Not tested AbGRI2-1 Protein 9e-13 49
qacEdelta1 AGF35063.1 QacEdelta1 Not tested SGI1 Protein 9e-13 49
qacEdelta1 CAJ77088.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 9e-13 49
qacEdelta1 AGK36647.1 QacEdelta1 Not tested AbaR26 Protein 9e-13 49
qacEdelta1 AGK06933.1 QacEdelta1 Not tested SGI1 Protein 9e-13 49
qacE-deltal ACF06159.1 quartenary ammonium compound resistance protein Not tested Tn5036-like Protein 9e-13 49
qacEdelta1 AAK02047.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 9e-13 49
qacEdelta1 AGK06970.1 QacEdelta1 Not tested SGI1 Protein 9e-13 49
qacE-delta1 ACY75523.1 QacE-delta1 Not tested Tn6060 Protein 9e-13 49
qacEdelta1 AAK02056.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 9e-13 49
qacEdelta1 AGK06979.1 QacEdelta1 Not tested SGI1 Protein 9e-13 49
qacE-delta1 ACY75532.1 QacE-delta1 Not tested Tn6060 Protein 9e-13 49
qacEdelta1 ABB48428.1 QacEdelta1 Not tested SGI1 Protein 9e-13 49
ACICU_00227 YP_001844886.1 membrane transporter Not tested AbaR20 Protein 1e-12 49
qacEdelta1 AGK07016.1 QacEdelta1 Not tested SGI1 Protein 9e-13 49
qacE-delta1 AET25389.1 QacE-delta1 Not tested PAGI-2(C) Protein 9e-13 49
qacEdelta1 ABZ01839.1 QacEdelta1 Not tested SGI2 Protein 9e-13 49
qacEdelta1 YP_005797134.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 1e-12 49
qacEdelta1 AGK07074.1 QacEdelta1 Not tested SGI1 Protein 9e-13 49
qacE-delta1 AFG30112.1 QacE-delta1 Not tested PAGI-2 Protein 9e-13 49
qacEdelta1 CAJ77030.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 9e-13 49
qacEdelta1 YP_005797150.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 1e-12 49
qacEdelta1 AGK07100.1 QacEdelta1 Not tested SGI1 Protein 9e-13 49
qacEdelta1 AGF34989.1 QacEdelta1 Not tested SGI1 Protein 9e-13 49
qacEdelta1 CAJ77049.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 9e-13 49
ebr YP_006098377.1 putative ethidium bromide resistance protein Not tested Tn2411 Protein 1e-12 49
unnamed CAD42067.1 hypothetical protein Not tested PAI II 536 Protein 5e-08 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
H045_23295 YP_007400213.1 SMR family multidrug resistance protein BAC0377 Protein 3e-19 57
H045_23295 YP_007400213.1 SMR family multidrug resistance protein CP004022.1.gene1549. Protein 4e-18 55
H045_23295 YP_007400213.1 SMR family multidrug resistance protein BAC0322 Protein 7e-14 52
H045_23295 YP_007400213.1 SMR family multidrug resistance protein CP001138.1.gene1489. Protein 6e-15 50
H045_23295 YP_007400213.1 SMR family multidrug resistance protein BAC0324 Protein 3e-13 50
H045_23295 YP_007400213.1 SMR family multidrug resistance protein BAC0323 Protein 4e-13 49
H045_23295 YP_007400213.1 SMR family multidrug resistance protein BAC0002 Protein 1e-16 48
H045_23295 YP_007400213.1 SMR family multidrug resistance protein NC_010410.6003348.p0 Protein 1e-16 48
H045_23295 YP_007400213.1 SMR family multidrug resistance protein NC_002695.1.913273.p Protein 1e-10 45
H045_23295 YP_007400213.1 SMR family multidrug resistance protein BAC0150 Protein 1e-10 44

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
H045_23295 YP_007400213.1 SMR family multidrug resistance protein VFG1586 Protein 2e-08 42